KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0882Help
Entry
A79E_0882         CDS       T02213                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kpp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
905155..906999
Genome map
AA seq 614 aa AA seqDB search
MTFEQLLLAAVEQRLLRPLDVQFALMVAQNDPPAVKLAAALLSRDAGEGHVCLPLSRLSG
DEALSGKAGEIRDRLLAEAGAPEDWPALLLASSAVSCGDAPAPMILCGDRLYLNRMWRNE
LTVARFFNEANRVLEMDEARLASTLNALFPATGETDWQKVAAAVALTRRISVISGGPGTG
KTTTVAKLLAALIQIEDSPRCRIRLAAPTGKAAARLTESLGAALRKLPLTDAQKALIPTE
ASTLHRLLGAQPGSQRMRYHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPAHGRVIFLG
DRDQLASVEAGAVLGDICAWASSGYTAARAQELTRLTGSPVPAGEGAIAGALRDSLCLLQ
KSYRFGSHSGIGSLARAVNAGARAEVKATLRQPFDDIALHPLSTTEEYEAMLGAAQHGYE
RYLQLRRERAEPQAMLAAFSEFQLLCALREGPYGVSGVNERLEQRLNRQRAIALPRHSRW
YDGRPIMISRNDSALGLFNGDIGIALERNGELRVWFLMPDGAIKSVQPSRLPEHDTAWAM
TVHKSQGSEFEHAALILPARSVPLVTRELVYTAITRAKRRLSLYADEQVLSQAIVTRTER
RSGLAEIFAGREAP
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgaacaactactgctggcggcggtggagcagcgtctgctgcggccgctggac
gtccagtttgccctgatggtggcgcaaaacgacccgccggcggtcaagctggcggcggcc
ttgctgagccgggatgccggcgaggggcacgtctgtctgccgctctcgcggttgagcggc
gacgaggcgctgagcggtaaagccggggagatccgcgatcggctgctggccgaagccggc
gcgccggaggactggcccgcactgctgctcgcttcgtcggcggtgagctgcggtgatgct
ccggcgccgatgattttgtgcggcgaccggctctatctcaaccggatgtggcgcaacgag
ctgaccgtcgcccgcttcttcaatgaagccaaccgggtgctggagatggatgaggcccgg
ctggcgtcaaccctgaatgccctgttccctgccaccggcgaaaccgactggcaaaaagtg
gccgcggcggtggcgctgacccgccgcatctcagtgatctccggcggtcccgggaccggg
aagaccaccaccgtggcgaagcttctggcggcgctgatccagatcgaagatagtccgcgc
tgtcgtattcgcctggcggcgccaaccgggaaagcggcggcgcgtctgaccgaatcgctg
ggcgcggcgctgagaaaattgccgctgaccgacgcgcagaaagcgttgattcccaccgag
gccagcacgctgcatcgtctgctgggcgcccagccaggcagccagcggatgcgctatcac
gccggcaacccgctgcatctggacgtgctggtggtggatgaagcctcgatgatcgacctg
ccgatgatgtcgcggcttatcgacgcgctgccggcccacgggcgggtgattttcctcggc
gatcgcgaccagctggcctccgtagaagcgggggcggtgctgggggatatctgcgcctgg
gcgagttcgggctataccgccgcgcgggcgcaggagctgacccggctgaccggttcgccg
gtgccggcgggcgagggggctatcgcgggcgcgctgagagacagtttgtgcctgctgcaa
aagagctatcgcttcggtagtcactccggcatcgggagcctggcgcgggcggtgaacgct
ggcgcgcgcgcggaggtgaaggccacgctgcgccagccgtttgacgatatcgcgcttcat
cccctcagcacgaccgaagagtacgaagccatgctcggcgcggctcagcatggctatgag
cgctacctgcagctgcgccgcgagcgggccgaaccgcaggccatgctggccgctttcagc
gaattccagctgctgtgcgcgctgcgcgaggggccgtacggcgtgagcggcgtcaatgag
cggctggagcagcggctcaaccgccagcgggcgatcgccctaccgcgccactctcgctgg
tatgacggccgaccgatcatgatatcgcgcaacgacagcgcgctggggctgtttaacggc
gatatcggcatcgccctggagcgcaacggcgagctgcgggtgtggttcctgatgcccgac
ggcgccatcaagtcggtgcagccgagccgtctgccggagcatgataccgcctgggcgatg
accgtgcataaatcgcagggctcggagttcgaacacgcggcgctgatcctgccggcgcgc
agcgtcccgctggtgacccgcgaactggtctacacggcgatcacccgcgcgaaacggcgg
ttgtcgctctatgccgacgagcaggtgctctcccaggccattgtgacgcgcaccgaacgg
cgcagcggcctggcggagattttcgccgggcgcgaagccccctga

DBGET integrated database retrieval system