KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0882Help
Entry
A79E_0882         CDS       T02213                                 

Definition
(GenBank) Exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A79E_0882
Enzymes [BR:kpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A79E_0882
DNA repair and recombination proteins [BR:kpp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     A79E_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase AAA_22 DUF2075 AAA_28 PhoH T2SSE UvrD_C AAA_16 MukB CbiA AAA SRP54 ATPase NTPase_1
Motif
Other DBs
NCBI-ProteinID: AFQ64258
Position
905155..906999
Genome map
AA seq 614 aa AA seqDB search
MTFEQLLLAAVEQRLLRPLDVQFALMVAQNDPPAVKLAAALLSRDAGEGHVCLPLSRLSG
DEALSGKAGEIRDRLLAEAGAPEDWPALLLASSAVSCGDAPAPMILCGDRLYLNRMWRNE
LTVARFFNEANRVLEMDEARLASTLNALFPATGETDWQKVAAAVALTRRISVISGGPGTG
KTTTVAKLLAALIQIEDSPRCRIRLAAPTGKAAARLTESLGAALRKLPLTDAQKALIPTE
ASTLHRLLGAQPGSQRMRYHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPAHGRVIFLG
DRDQLASVEAGAVLGDICAWASSGYTAARAQELTRLTGSPVPAGEGAIAGALRDSLCLLQ
KSYRFGSHSGIGSLARAVNAGARAEVKATLRQPFDDIALHPLSTTEEYEAMLGAAQHGYE
RYLQLRRERAEPQAMLAAFSEFQLLCALREGPYGVSGVNERLEQRLNRQRAIALPRHSRW
YDGRPIMISRNDSALGLFNGDIGIALERNGELRVWFLMPDGAIKSVQPSRLPEHDTAWAM
TVHKSQGSEFEHAALILPARSVPLVTRELVYTAITRAKRRLSLYADEQVLSQAIVTRTER
RSGLAEIFAGREAP
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgaacaactactgctggcggcggtggagcagcgtctgctgcggccgctggac
gtccagtttgccctgatggtggcgcaaaacgacccgccggcggtcaagctggcggcggcc
ttgctgagccgggatgccggcgaggggcacgtctgtctgccgctctcgcggttgagcggc
gacgaggcgctgagcggtaaagccggggagatccgcgatcggctgctggccgaagccggc
gcgccggaggactggcccgcactgctgctcgcttcgtcggcggtgagctgcggtgatgct
ccggcgccgatgattttgtgcggcgaccggctctatctcaaccggatgtggcgcaacgag
ctgaccgtcgcccgcttcttcaatgaagccaaccgggtgctggagatggatgaggcccgg
ctggcgtcaaccctgaatgccctgttccctgccaccggcgaaaccgactggcaaaaagtg
gccgcggcggtggcgctgacccgccgcatctcagtgatctccggcggtcccgggaccggg
aagaccaccaccgtggcgaagcttctggcggcgctgatccagatcgaagatagtccgcgc
tgtcgtattcgcctggcggcgccaaccgggaaagcggcggcgcgtctgaccgaatcgctg
ggcgcggcgctgagaaaattgccgctgaccgacgcgcagaaagcgttgattcccaccgag
gccagcacgctgcatcgtctgctgggcgcccagccaggcagccagcggatgcgctatcac
gccggcaacccgctgcatctggacgtgctggtggtggatgaagcctcgatgatcgacctg
ccgatgatgtcgcggcttatcgacgcgctgccggcccacgggcgggtgattttcctcggc
gatcgcgaccagctggcctccgtagaagcgggggcggtgctgggggatatctgcgcctgg
gcgagttcgggctataccgccgcgcgggcgcaggagctgacccggctgaccggttcgccg
gtgccggcgggcgagggggctatcgcgggcgcgctgagagacagtttgtgcctgctgcaa
aagagctatcgcttcggtagtcactccggcatcgggagcctggcgcgggcggtgaacgct
ggcgcgcgcgcggaggtgaaggccacgctgcgccagccgtttgacgatatcgcgcttcat
cccctcagcacgaccgaagagtacgaagccatgctcggcgcggctcagcatggctatgag
cgctacctgcagctgcgccgcgagcgggccgaaccgcaggccatgctggccgctttcagc
gaattccagctgctgtgcgcgctgcgcgaggggccgtacggcgtgagcggcgtcaatgag
cggctggagcagcggctcaaccgccagcgggcgatcgccctaccgcgccactctcgctgg
tatgacggccgaccgatcatgatatcgcgcaacgacagcgcgctggggctgtttaacggc
gatatcggcatcgccctggagcgcaacggcgagctgcgggtgtggttcctgatgcccgac
ggcgccatcaagtcggtgcagccgagccgtctgccggagcatgataccgcctgggcgatg
accgtgcataaatcgcagggctcggagttcgaacacgcggcgctgatcctgccggcgcgc
agcgtcccgctggtgacccgcgaactggtctacacggcgatcacccgcgcgaaacggcgg
ttgtcgctctatgccgacgagcaggtgctctcccaggccattgtgacgcgcaccgaacgg
cgcagcggcctggcggagattttcgccgggcgcgaagccccctga

DBGET integrated database retrieval system