KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0941Help
Entry
A79E_0941         CDS       T02213                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A79E_0941
Enzymes [BR:kpp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     A79E_0941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(957200..958975)
Genome map
AA seq 591 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEAQTMNMAKATAALISEKLRHACGARVECVIADT
CIAGMAESAACEEKFSSQNVGVTITVTPCWCYGSETIDMDPLRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSL
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDETELEMALAWADKHFRY
GEDQNAEQYKRNETQSRAVLKESLLMAMCIRDMMQGNPKLAEKGLVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEALLNSSFDWNGVREPFVVATENDSLNGVAMLMGHQLTGTAQVFA
DVRTYWSPDAVERVTGQPLTGRAEHGIIHLINSGSAALDGSCQQRDAQGNPTMKPHWEIE
QSEADACLAATEWCPAIHEYFRGGGFSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VALPKAMHDQLDARTNSTWPTTWFAPRLTGKGPFSDVYSVMANWGANHGVLTIGHVGADF
ITLAAMLRIPVCMHNVEEAKIYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaagatcggtattcgtccggtaatcgatggtcgtcgcatg
ggggtccgcgagtcgctggaagcgcaaaccatgaacatggcgaaagccaccgccgcgctt
atcagcgagaaactgcgccacgcctgcggcgcccgggtggagtgcgtgattgccgatacc
tgcatcgccggcatggccgagtcggccgcctgtgaagagaaattcagcagccagaacgtc
ggcgtcaccatcaccgtcaccccctgctggtgctacggcagcgaaaccatcgacatggat
ccgctgcgcccgaaggccatctggggctttaacggcaccgagcgtccgggggcggtctat
ctggccgcggcgctggcggcccatagccagaaagggatcccggcgttctccatctacgga
catgacgtgcaggatgccgatgacacctcgatcccggcggatgtcgaagaaaagctgttg
cgcttcgctcgcgccggcctggctgtcgccagtatgaaagggaaaagctatctgtcgctg
ggcggcgtctcaatgggcatcgccggatctatcgtcgaccacaacttttttgagtcctgg
ctcggcatgaaggtgcaggctgtcgacatgacggagctgcgccggcgaatcgatcaaaaa
atctatgatgaaaccgagctggagatggcgctggcgtgggcggataaacacttccgctac
ggcgaagatcagaacgctgagcagtataagcgcaatgaaacgcagagccgcgcggtgctg
aaagagagcctgctgatggcgatgtgcatccgcgacatgatgcagggtaacccgaagctc
gcagaaaaagggctggtggaggagtcgctgggttacaacgccatcgccgccggtttccag
ggtcagcgccactggaccgatcaataccccaatggcgataccgccgaagcgctgctcaac
agctcttttgactggaacggggtgcgcgaaccgtttgtcgtcgctaccgaaaacgacagc
ctcaacggcgtggccatgctgatgggccatcagctcaccggcaccgcccaggtgtttgcc
gacgtacgcacctactggtcgccggatgccgttgaacgggtcaccgggcagccgctcacc
gggcgggcggagcacggcatcattcacctgattaactccggctctgcggcgctggacggc
tcctgccagcagcgcgacgcgcagggcaatccgacgatgaaaccccactgggagattgag
cagagcgaggcggatgcctgcctcgcggcgaccgaatggtgcccggcgatccacgaatac
ttccgcggcggcggcttctcttcccgcttcctgaccgaaggcggcgtgccgttcaccatg
acccgggtgaacatcatcaaaggtctggggccggtgctgcaaattgccgaaggctggagc
gtagcgctgcccaaagcgatgcacgaccagctcgacgcccgcaccaactccacctggccc
accacctggtttgccccacgcctgaccggcaagggcccgttcagcgatgtgtactcggtg
atggccaactggggcgccaaccacggcgtgctgaccatcggccacgttggcgcagatttc
attaccctcgccgccatgctgcgcattccggtctgcatgcacaacgtggaagaggcgaaa
atctatcgcccttccgcctgggccgcgcacggcatggatatcgagggccaggactaccgc
gcctgccagaactacgggccgctgtataagcgttaa

DBGET integrated database retrieval system