KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0993Help
Entry
A79E_0993         CDS       T02213                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Brite
Enzymes [BR:kpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     A79E_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1018433..1019059
Genome map
AA seq 208 aa AA seqDB search
MVSKRVESLLNQLRTQGIVDERVLEAIALVPREKFVDEAFEHKAWENTALPIGQGQTISQ
PYMVARMTELLTLTPESRVLEIGTGSGYQTAILAHLVHHVCSVERIKSLQWQARRRLKQL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALLAQLDDDGVLVLPVGEEHQFLK
RIRRRGNEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtaaacgtgttgaaagtttgttgaatcaactgcgcacgcagggcatcgtcgat
gaacgtgtcctcgaggcgatcgcgctggtcccgcgcgaaaagtttgttgatgaagccttt
gaacataaagcgtgggaaaacaccgcgctgccgattggccaggggcagaccatctcccag
ccgtatatggtggcgcggatgaccgagctgctgacgctgacgccggagtcgcgggtgctg
gagatcggcaccggttccggctaccagacggccatcctggcgcatctggtgcatcacgta
tgctcggtagagcgaattaagagtttacagtggcaggcgcgtcgtcgcctgaaacaactt
gatttacataatgtttcaacccgtcatggcgatgggtggcaaggttggcaggcgcgggcg
ccgtttgatgccattattgtgacggcggcgccgccggaaataccgaccgcgctgctggcg
cagctggatgatgacggcgtgctggtgctgccggtcggcgaagagcatcagtttctcaaa
cggatccgtcgtcggggcaacgaatttatcattgataccgtcgaggccgttcgctttgtt
cccctggtgaagggggagctggcctga

DBGET integrated database retrieval system