KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_1027Help
Entry
A79E_1027         CDS       T02213                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A79E_1027
Enzymes [BR:kpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     A79E_1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1053979..1055379
Genome map
AA seq 466 aa AA seqDB search
MQQYQFPQGFLWGAAASGPQTEGVTNKRHRSIWDSWFAEQPERFYQQVGPQTVCDTYHQY
PQDVALMKQTGFNSFRTSIQWSRLIADLETGAPDPDAVRFYHAYLDEMIANGIEPMINLY
HFDMPEALQKQYGGFESAHVAELFARFARTAFSLFGHKVKYWITFNEPIVPVEGGYLYDF
HYPCKKDGRLAAQVAFNIMLAHAKAVTAYRELALAGEIGVVLNLTPSYTLTDSDADKKAA
GYADLFFNRSFLDPLVKHEFPKALCEILAAHDCLPTTSKDDAALILSADIDFLGVNYYVP
RRVKARESEYDLDYFTPEYYFENAVNPQGRFNPYRDNNEILPQAIYDIAANIRDNYGNIK
WYLAEIGIAMDRQSEGEPGADGVIDDTFRIQLMEEHLVQLHRAIADGANCFGVHQWTFID
NWSWINAFKRRYGFWRLDLETGERQIKRNALWFAELASSNGFTSDK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagtatcagtttccgcaagggttcctgtggggggcggcggcgtccggcccgcaa
acggaaggggtcaccaataagcgccatcgttccatctgggacagttggtttgccgaacag
ccggagcgattttatcagcaggtagggccgcagaccgtgtgtgatacttatcatcagtat
ccgcaggacgtagcgctgatgaaacagaccggcttcaactcatttcgtacctcgatacag
tggtcacgactgatcgctgatttggaaaccggcgcgccggacccggacgcggtgcgtttt
tatcacgcctatctggatgagatgatcgccaacggcattgagccgatgatcaatctctac
cactttgatatgccggaagcgctgcagaaacagtacggcggctttgaatcggcgcacgta
gccgagctgtttgcccgctttgcccgcaccgcctttagcctgtttggccataaggttaaa
tactggataaccttcaacgagccgattgtgccggttgagggaggctacctgtacgacttc
cactatccatgtaagaaagatggccggctggcggcgcaggtggcgtttaacattatgctg
gcgcacgccaaagcggtaacggcttatcgtgaactggcgctggcgggcgagatcggcgtg
gtgctcaacctgaccccgagctataccctcaccgacagcgacgcggataaaaaagccgcc
gggtatgccgacctgttttttaaccgcagcttccttgacccgctggtaaaacatgaattc
cccaaagcgctgtgcgagatccttgccgcccacgactgcctgccgacgaccagcaaagac
gacgcggcgttgatcctcagcgcggatatcgattttcttggggtaaactattacgtgccg
cggcgggtaaaagcgcgtgagagcgaatatgacctcgattatttcaccccggaatactat
ttcgaaaacgcggtgaacccgcagggccgctttaatccttatcgtgataacaacgagatc
ctgccgcaggcgatctatgacattgccgccaatattcgcgataactacggcaatattaag
tggtatctcgcggaaatcggcatcgcgatggatcgacaatcagagggcgagcccggggcg
gacggggtgatagacgatactttccgcatccagctgatggaggagcatctggtgcagctg
catcgggcgatagccgacggcgcgaactgctttggcgtgcaccagtggacgtttatcgac
aactggtcgtggatcaatgccttcaaacggcgctacggcttctggcgactggatctggag
accggcgagcgacagataaaacgcaatgcgctgtggtttgccgaactggcgtccagcaac
ggttttaccagcgataaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system