KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_1363Help
Entry
A79E_1363         CDS       T02213                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00010  Glycolysis / Gluconeogenesis
kpp00052  Galactose metabolism
kpp00500  Starch and sucrose metabolism
kpp00520  Amino sugar and nucleotide sugar metabolism
kpp00521  Streptomycin biosynthesis
kpp01100  Metabolic pathways
kpp01110  Biosynthesis of secondary metabolites
kpp01120  Microbial metabolism in diverse environments
kpp01130  Biosynthesis of antibiotics
kpp01200  Carbon metabolism
Module
kpp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kpp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A79E_1363
   00052 Galactose metabolism
    A79E_1363
   00500 Starch and sucrose metabolism
    A79E_1363
   00520 Amino sugar and nucleotide sugar metabolism
    A79E_1363
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A79E_1363
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    A79E_1363
Enzymes [BR:kpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     A79E_1363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AFQ64717
Position
1401655..1402488
Genome map
AA seq 277 aa AA seqDB search
MRVYLEEHQVTVNEGCIAIACPITGDWVAMTNHTWAFSIAEMKRNLGFAHLEIINDFTAV
SMAIPMLKAEHLIQFGGSAPVAGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFA
PNSEEEGIILEELRAELGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPREVTERALA
DSCTDCRRALSLFCVIMGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDK
GRFKAYVQDIPVYLIVHDNPGLLGSGAHLRQTLGQVL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtctacctcgaggagcaccaggtaacggtcaacgaaggttgtatcgccatcgca
tgcccgattaccggcgactgggtggcgatgaccaaccatacctgggctttctctatcgcc
gaaatgaagcgtaacctcggctttgcccatctggagataattaacgattttaccgctgtt
tcaatggccattccgatgctgaaagctgagcaccttattcagtttggcggcagtgcgccg
gtagcgggcaaaccgatcgccgtttatggcgccgggaccgggctcggcgtggcgcatctg
gtccacgttgataagcgttgggtcagcctgccgggcgaaggcggtcatgttgattttgcc
ccgaacagcgaagaagaagggatcattctggaagagctacgcgccgagctggggcatgtt
tccgcagaacgcgtgctctcaggtcccgggctggtcaacctgtatcgcgcgattgtcaaa
tcggacggccgactgccggagaacctgcagccgcgtgaggtgaccgagcgagcgctggcg
gacagctgcaccgactgtcgtcgggcgctgtcgctgttctgcgtcattatgggacgcttc
ggcggtaacctggcgctgaccctcgggacgtttggcggggtgtatatcgccggcggcatc
gtgccgcgcttcctggagttctttaaagcctctggtttccgcggcggttttgaagacaaa
ggccgttttaaagcttatgttcaggatatcccggtttacctgattgtgcatgataaccca
ggcctgctgggctccggcgcgcatctgcgtcagacgctgggccaggtgctttaa

DBGET integrated database retrieval system