KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_1512Help
Entry
A79E_1512         CDS       T02213                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A79E_1512
Enzymes [BR:kpp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     A79E_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1568697..1569365
Genome map
AA seq 222 aa AA seqDB search
MSSLSKEAVLVHEALVARGLETPMRAPVQEIDNETRKRLITGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFSGLDYSRFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactgagtaaagaagccgtcctcgttcatgaagcgctggtcgctcgtgggctg
gagacgccgatgcgtgcgccagtacaagaaattgataacgaaacacgcaagcgtttgatt
accggtcatatgaccgagattatgcaactgctgaatctggatctgagtgatgacagtctg
atggagaccccgcatcgcatcgccaaaatgtatgtcgatgagatcttctccgggctggat
tattctcgcttcccgaaaatcaccgtcattgaaaacaaaatgaaggtcgatgaaatggtc
accgtgcgcgatatcaccctgaccagcacctgcgaacaccatttcgttaccatcgatggt
aaagcgacggtagcctatatcccgaaagattcggtgatcggcctgtcgaaaatcaaccgc
atcgtgcagttcttcgcccaacgtccgcaggtccaggagcgtctgacgcagcagatcctg
atcgcgctgcagacgctgctcggcaccaacaacgtggcggtatccattgacgcggtgcat
tattgcgtgaaggcgcgcggcattcgcgacgcgaccagcgccaccaccaccacctctctc
ggcggcctgtttaaatccagccagaatacccgccaggaattcctgcgcgcagtacgtcac
cacaactaa

DBGET integrated database retrieval system