KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_1629Help
Entry
A79E_1629         CDS       T02213                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A79E_1629
  Amino acid metabolism
   00340 Histidine metabolism
    A79E_1629
Enzymes [BR:kpp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     A79E_1629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1711941..1713245)
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNGCSADQQQQLLTRPAISASDSISKTVTEILNNVKANGDAALREYSAKFDK
TTVAALQVSEAEIAAAGERLSDELKQAMAVAVKNIETFHNAQQLQAVDVETLPGVRCQQV
TRPIASVGLYIPGGSAPLFSTVLMLATPARIAGCQQVVLCSPPPIADEILYAAQLCGVKT
IFNVGGAQAIAALALGTESVPKVDKIFGPGNAYVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGANPDFVASDLLSQAEHGPDSQVILLTPDADMGSRVAEAVERQLAALPRAETARV
ALSASRIIVARDLAQCVAISNLYGPEHLIIQTRQARELVDSITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSRDGFAALASTIEILAAAERLDAHK
NAVTLRVAALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaacacaatcatcgactggaacggctgtagcgcagaccaacaacagcaactc
ttaacgcgcccggcgatttccgcctccgacagcatcagtaaaacggtgacggagatcctg
aataacgtcaaagccaacggcgacgcggcgctgcgcgaatacagcgcgaagtttgataaa
accaccgtcgccgcgctgcaggtgagcgaggcggagatcgccgccgccggcgagcgcctc
agcgatgagctgaagcaggcgatggcggtggcggtgaaaaacatcgagacctttcacaac
gcgcaacagctgcaggcggtggatgtcgaaacgctgccgggggtgcgctgccagcaggtc
acccgccctatcgcctccgtcggactgtacattcccggcggctcagcgccgctgttctcc
acggtgctgatgctggcgacgccggcgcgcatcgccggctgtcagcaggtggtgctctgc
tcgccgccgccgattgccgatgagatcctctatgccgcacagctgtgcggcgtaaaaacc
atctttaacgtcggcggcgcccaggccatcgccgccctcgccctcggtaccgagtcggtg
ccgaaggtggataaaatctttggcccgggcaacgcttacgtcacggaagccaaacgccag
gtcagtcagcgtctggacggcgcagccatcgacatgccggccggcccgtcggaagtgctg
gtcatcgccgacagcggcgccaacccggactttgtcgcctccgacctgctgtcgcaggcg
gaacacggcccggactcgcaggtgatcctcctgaccccggacgccgacatgggcagccgc
gtcgccgaagccgtggagcgccagctggccgccctgccgcgcgcggaaaccgcccgcgtg
gcgctctccgccagccggatcatcgtggcccgcgatctggcgcagtgcgtggctatctcc
aacctgtacggcccggagcacctgatcattcagacccgtcaggcccgcgagctggtggac
agcatcaccagcgccggttccgtttttcttggcgactggtcaccggaatccgcgggcgac
tacgcctcgggcaccaaccacgtcctgccgacctatggttacaccgccacctgctcaagc
ctcggcctggccgacttccagaagcggatgaccgtgcaggagctgtcgcgcgacggcttt
gccgccctcgcctcaacgattgagatcctggccgccgccgagcgccttgacgcccacaaa
aacgccgtaacgctgcgcgttgccgccctgaaggagcaagcatga

DBGET integrated database retrieval system