KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_1734Help
Entry
A79E_1734         CDS       T02213                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A79E_1734
Enzymes [BR:kpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     A79E_1734
Exosome [BR:kpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A79E_1734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1872149..1873171
Genome map
AA seq 340 aa AA seqDB search
MSIIIPGSFPARRLRRSRTHSFSRRLVAENQLTVDDLILPVFIIEGQNLRQEVPSMPGVF
RLSVDMLLHDAAQFVQAGIPAIALFPCIESSAKSLMADASWDPSGLVPRAVRALKKAFPE
LGVITDVALDAYTTHGQDGITDENGYVLNEPTKEILTRQALTHAEAGADIVAPSDMMDGR
IGHIRQAFETNGLLNIQIMAYSAKYASNYYGPFREATKSAVSLGKRDKKSYQMDPANAME
AMHEIAQDLQEGADMVMVKPGMPYLDIIREARKTFAVPVFAYQVSGEYTMHMAAFRNGWL
DEEKTVLESLMCFKRAGADGILTYFANTVAQLLNQHKREY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattattattcctggttctttcccggcacgacgactgcgccgttctcgcacccat
tctttcagtcgccgtctggtcgctgaaaatcagctgaccgtagatgacctgattttaccg
gtattcattattgaggggcaaaacctgcgacaggaagtgccgtcgatgccgggcgtattt
cgtctgtcggttgatatgttgcttcatgatgccgcgcaatttgttcaggcaggtatacct
gctattgcactatttccgtgtatagaaagttctgctaaatcgctgatggcagacgcttcg
tgggatccatccggtttagtaccgcgagctgtaagggcgctgaaaaaggcttttcctgaa
ctcggggtgataactgacgttgctcttgacgcctatacgacacatggtcaggacggcatc
actgacgaaaatggatatgtacttaatgagccgacaaaagaaattctcaccagacaggcg
cttacccacgccgaagcaggcgcagatattgtcgctccaagcgacatgatggatggccgc
atcggtcatatcagacaagcgtttgaaacgaatggactgcttaatatccagataatggcg
tattcagcaaaatacgcgtcgaactattatggtccttttcgcgaggcgacgaaatctgct
gtatcactgggtaaacgggacaaaaaaagctatcagatggatccggcgaatgcaatggaa
gctatgcatgaaattgcccaggatttgcaggaaggggcagacatggtgatggttaagccg
ggcatgccttacctggatattatcagggaagccaggaaaacttttgcagtacccgtcttt
gcctatcaggtttcaggggaatatacgatgcatatggccgctttccgaaatggttggctg
gacgaagaaaaaacggtgcttgaatcacttatgtgcttcaaacgcgccggggcggatgga
atactgacttattttgccaatacagtagcccagttgcttaatcaacataaacgggaatat
tga

DBGET integrated database retrieval system