KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_1814Help
Entry
A79E_1814         CDS       T02213                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:kpp00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1967177..1968163
Genome map
AA seq 328 aa AA seqDB search
MSLQNLTRFPRLELIGAPTPLEYLPRLSDHLGREIFIKRDDTTPLAMGGNKLRKLEFLAA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTRAENYLSNGNRLLLD
LFNTQVEMCDALTDPAAQLDELATRIEAQGYRPYVIPVGGSNALGALGYVESALEISQQC
EDAVAISSVVVASGSAGTHAGLAVGLEQLMPQAELIGVTVSRSVADQLPKVVALQQAVAN
SLELQAKAEIILWDDYFAPGYGTPNEDGMAAVKLLAQLEGILLDPVYTGKAMAGLIDGIT
QKRFKDEGPILFVHTGGAPALFAYHPHL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaaaacttaacccgctttccgcgcctggaattgatcggcgcgccgacgccg
ctggagtatctcccgcgtctgtccgatcaccttgggcgcgaaatttttattaaacgtgat
gatacgacgccgctggcgatggggggcaacaaactgcgtaagctggagtttctcgccgcc
gatgcgctgcgcgagggcgcggataccttaatcaccgccggcgcgatccagtctaaccat
gtgcgtcagacggcggcagtcgctgcgaaactggggctgcattgcgtggcgctactggaa
aatcccatcggcacccgggcggagaactatctgagcaatggcaaccgtctgctgctggat
ctctttaacacccaggttgagatgtgtgatgccctgaccgatcccgccgcccagctcgat
gagctggcgacccgcattgaggcgcaggggtatcgtccgtatgttattccggtcggcggc
tccaatgccctcggcgcgttaggctatgtggaaagcgcactggaaatcagccagcagtgc
gaagacgcggtggcgatctcgtcagtcgtggtcgcctccggcagcgccggcacccatgcc
ggattggcggtcggccttgaacagctgatgccgcaggcggaactgattggggtgaccgtg
tcgcgctcggtcgctgaccagttgccgaaagtggtggcgctgcagcaggccgtggccaac
agtctcgagctacaggcgaaggctgaaattatactgtgggatgactactttgccccagga
tacggtacgccaaacgaagatgggatggccgccgtgaagctgctggcgcagctggaaggt
attttgctcgacccggtctataccggcaaagcgatggccgggcttatcgacggcatcacg
cagaagcgctttaaggatgaagggccgatactgttcgtccataccggcggagcgccggcg
ctgtttgcctatcatcctcacctctaa

DBGET integrated database retrieval system