KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_1856Help
Entry
A79E_1856         CDS       T02213                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A79E_1856
Enzymes [BR:kpp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     A79E_1856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2005609..2006220
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETAGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVASLVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPAGPTADDAEQEAVAALVALGYKPQEASRM
VSKIARPDANSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcattctcgaaaaacaacccccgctggtgttgctggaa
acggcgggcgtcggctatgaagtgcatatgccaatgacctgcttctatgagctgccggag
gccgggcaggaggcgatcgtcttcacccactttgtggtgcgtgaagatgcccagctgctg
tatgggtttaacaacaaacaggaacgtaccctgtttaaagagctgattaaaaccaacggc
gtggggcccaagctggcgctggcgatcctctccggcatgtcggcgcagcagttcgtcaac
gccgttgaacgggaagaggtcgcctcgctggtgaagctgccggggattggcaaaaaaacc
gctgaacgtctgatcgttgagatgaaagaccgcttcaaagggctgcacggcgacctgttc
accccggcggccgatctggtgctgacctcgccggcaggcccaacggcggacgatgccgag
caggaagcggttgccgcgctggtcgcgctgggctataaaccgcaggaggccagccggatg
gtcagcaagatcgcgcgtccggacgccaacagtgaaacgctaattcgcgaagcgctgcgc
gctgcgttgtga

DBGET integrated database retrieval system