KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_1997Help
Entry
A79E_1997         CDS       T02213                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00900  Terpenoid backbone biosynthesis
kpp01100  Metabolic pathways
kpp01110  Biosynthesis of secondary metabolites
kpp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A79E_1997
Enzymes [BR:kpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     A79E_1997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFQ65308
Position
complement(2149004..2149852)
Genome map
AA seq 282 aa AA seqDB search
MTRWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLTIEPRSDGQLRLLTPVAGVP
DEENLIVRAARLLMHAASESDRLPAGSGADISIDKRLPMGGGLGGGSSNAATVLVALNHL
WGCGLSEDELATLGLQLGADVPVFVRGHAAFAEGVGEILTPVEPEEKWYLVAHPGVSIPT
PIIFRDPELPRNTPRRSINTLLNCEFSNDCELIARKRFREVDAALSWLLEYAPSRLTGTG
ACVFAEFNTESAARQVLDTAPAWLNGFVARGVNLSPLKQALL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacccgctggccctctcctgcaaaactgaatctgtttttatatatcaccggccagcgg
gccgatggttaccataccctgcaaacgctgtttcagtttctcgattacggcgatacgttg
accatcgaaccgcgtagtgacggccaactgcgtctgctgacgccggtggccggcgtgccg
gacgaggagaatctgatcgttcgcgccgcgcgtctgctgatgcatgccgccagcgaaagc
gatcgcctgccggcgggcagcggcgccgatatcagtatcgataagcgcctgccgatgggc
ggcggcctgggcggtggctcctccaatgccgccaccgtgctggtggcgctcaaccatctg
tggggctgcggtctctcggaagatgagctggcgactcttggccttcagctgggggccgat
gtgccggttttcgtgcgcggccatgccgccttcgccgagggggtgggtgaaatactgacg
ccggtagaacccgaggaaaaatggtacctggtggcccacccgggggtcagtattccgacg
ccgatcatttttcgcgatccggagctaccacgaaataccccgcgccggtcaattaatacg
ttattaaattgtgaattcagcaacgattgcgagcttatcgcaagaaaacgttttcgcgag
gttgatgccgcgctttcctggctgttagaatatgcgccgtcacgcctgaccggcacaggg
gcctgtgtgtttgctgaatttaacaccgaatccgctgcccgtcaggtgctggacactgcc
ccggcatggctaaatggctttgtggcgcgcggagttaacctttcgccgctcaagcaggcc
ctgctctga

DBGET integrated database retrieval system