KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_2034Help
Entry
A79E_2034         CDS       T02213                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A79E_2034
   00052 Galactose metabolism
    A79E_2034
   00500 Starch and sucrose metabolism
    A79E_2034
   00520 Amino sugar and nucleotide sugar metabolism
    A79E_2034
Enzymes [BR:kpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     A79E_2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2189747..2190649
Genome map
AA seq 300 aa AA seqDB search
MAALNSKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLSRDNLAEMISRFDETGASQIMVEPVEDVTAYGV
VDCKGESLKPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHKTLGDDFKAWLETAVAK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattctaaagtcagaaaagcggttatcccggttgcgggattaggcacc
aggatgctgccggccaccaaagcgattccaaaagaaatgctgccgctggtagataagccg
ttaattcagtacgttgttaatgaatgtatcgctgcaggaattactgaaattgttctggta
acgcactcgtcgaaaaactctatcgaaaaccatttcgataccagttttgagctggaagcg
atgctggaaaaacgtgtaaaacgccagctgctggaagaagtgcagtctatttgcccgccg
cacgtgactattatgcaagttcgtcagggcctggcgaaaggtctgggtcacgcggtgctg
tgcgcccatccggtagtgggagatgagccggtcgcggttattctgccagacgttattctg
gatgaatatgaatccgatctgagccgcgataacctcgctgagatgatctctcgcttcgat
gagactggcgccagccagattatggttgaacctgtcgaagacgtaaccgcttatggcgtg
gttgactgcaaaggcgaatccctgaagccgggcgaaagcgtaccgatggtgggcgtggtt
gagaagccaaaagctgacgttgcgccgtccaacctggcggtggtggggcgttatgtcctc
agcgccgatatctggccgctgctggcgaaaacccctccgggcgctggtgatgaaattcag
ctgactgacgccattgatatgctgatcgagaaagaaacggttgaagcttatcatatgaaa
ggcaagagccatgactgcggtaataagcttggctacatgcaggcgtttgtcgaatatggt
attcgtcacaaaacgctgggcgacgattttaaagcctggctggaaacggcggtagcgaag
taa

DBGET integrated database retrieval system