KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_2056Help
Entry
A79E_2056         CDS       T02213                                 

Definition
(GenBank) 6-phosphofructokinase class II
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00010  Glycolysis / Gluconeogenesis
kpp00030  Pentose phosphate pathway
kpp00051  Fructose and mannose metabolism
kpp00052  Galactose metabolism
kpp00680  Methane metabolism
kpp01100  Metabolic pathways
kpp01110  Biosynthesis of secondary metabolites
kpp01120  Microbial metabolism in diverse environments
kpp01130  Biosynthesis of antibiotics
kpp01200  Carbon metabolism
kpp01230  Biosynthesis of amino acids
Module
kpp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A79E_2056
   00030 Pentose phosphate pathway
    A79E_2056
   00051 Fructose and mannose metabolism
    A79E_2056
   00052 Galactose metabolism
    A79E_2056
  Energy metabolism
   00680 Methane metabolism
    A79E_2056
Enzymes [BR:kpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A79E_2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AFQ65364
Position
complement(2210184..2211116)
Genome map
AA seq 310 aa AA seqDB search
MTKIYTLTLAPSLDSATQTPQIYPEGKLRCSAPVFEPGGGGINVARAVTFLGGKATAIFP
VGGATGEHLAALLADEQVPVETVETRDWTRQNLHVHVAASGEQYRFVMPGAALTDDEFRR
LEEKVLTIEPGSLLVVSGSLPPGISVDNLMQLVKNAQQQGLRCIIDSSGDALAAALDVGN
IELVKPNQKELSALVQRDLSQPDDVRLAAQSLIQSGKVRRVVVSLGPQGALGVDASGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLAENASLEDMVRFGVAAGSAATINQGTRLCSRTNT
QKIYDYLCGR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatttacacgctcacgctggccccctcgctggatagcgccacgcaaacccca
cagatctacccggaaggcaaacttcgctgcagcgcgccggtatttgaacctggcggcggc
gggatcaacgtggcccgcgccgtgacctttctcggcggcaaagccaccgccattttcccg
gtcggtggcgctaccggcgagcatcttgccgccctgctggccgatgagcaggtgccggtc
gagaccgtcgaaacccgcgactggacgcggcaaaacctgcacgtccacgtggccgccagc
ggcgaacagtatcgcttcgttatgcccggcgcggcactgacggacgatgaattccgccgt
ctggaagagaaggttctgactatcgaacccggctctctgctggtggtcagcggcagcctg
ccgccaggtattagcgtcgataatctgatgcaactggtgaaaaatgcgcaacagcaggga
ctgcgctgcatcattgacagttccggcgatgcgctggccgccgcgctggacgtcggcaat
attgagctggtgaaaccgaaccagaaagagcttagcgccctcgtgcagcgcgatctcagc
caacccgatgacgtgcgccttgccgctcagtcgttgatccagtccggtaaagtgcgccgg
gtggtggtctccctgggtccgcagggggcgttaggcgtggacgccagcggcagcgttcag
gtagtgccgccaccgatgaaaagccagagcaccgtcggcgctggcgacagcatggtgggc
gccatgaccttgcgtctggcggaaaacgccagccttgaagacatggtacgctttggcgtc
gccgccggtagcgccgcgaccatcaaccagggcacccgcctctgctcgcggaccaatacg
caaaaaatctatgattatctctgcgggcgttga

DBGET integrated database retrieval system