KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_2072Help
Entry
A79E_2072         CDS       T02213                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:kpp00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:kpp00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2226853..2227404
Genome map
AA seq 183 aa AA seqDB search
MQHDILNTEVTTIDGEKTTLASFAGKVLLIVNVASKCGLTPQYEQLEDLQKQFAAEGFSV
LGFPCNQFLGQEPGSEEEIKTFCSTTYGVTFPLFSKIDVNGEHRAPLYQKLIAAAPKAVA
PEGSGFYERMASKGRAPLYVDDILWNFEKFLIDRQGNVIQRFSPDMTPDDPQLVAAIKGA
LAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatgacattctgaataccgaagtgacgaccattgatggcgagaaaaccaccctg
gcatcctttgccggcaaggtgctgctgatcgtcaatgtagcctcgaaatgcggcctgacg
ccgcagtatgagcaactcgaggatctgcaaaagcagtttgccgccgagggcttcagcgtg
ctggggttcccctgcaaccagttcctcggccaggagccgggcagtgaagaggagattaag
accttctgcagcactacctacggcgtcaccttcccgctgtttagcaaaattgacgtcaac
ggcgaacatcgcgcgccgctctatcaaaaactgattgccgccgcgccgaaagcggtggcc
ccggaaggcagcggtttttatgagcggatggccagcaaaggccgggcaccgctgtatgtg
gacgacattctgtggaatttcgaaaaattcctcatcgatcgccagggcaacgtcattcag
cgcttctctccggatatgacgccggacgatccgcagctggtggcggcgattaaaggagcg
ctggcgcaataa

DBGET integrated database retrieval system