KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_2499Help
Entry
A79E_2499         CDS       T02213                                 

Definition
acetylornithine deacetylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kpp01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:kpp00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2656507..2657649)
Genome map
AA seq 380 aa AA seqDB search
MTATLELARQLLGFNTINPPGSEADCMRFFADWLDDSGFEVSLSSFGEGRCNLIASLPGA
KSGKPLAFTGHLDTVPLGNARWQYDPFGSQMEDGRLYGRGSSDMKAAIAAFAVACVHQRE
AILAGRGAVLLITGGEETGCDGARALIASATLPEVGALIVGEPTANYPVIGHKGALWLRC
ETRGKTAHGAMPELGINAIYLAADALGKIQHFSPGAPHPLMKQPTLNVGRIEGGLNINSV
PDRTRFDVDIRSAPNLQHATIRERLTTLLGESVTVSTLVDLPAVLSREDHAWIKQVYQRC
QPLHAEPIAPRVVPYFTDASLLLPALGDPPCIILGPGEPSMAHQTDEYCLLSRLAEAEQL
YGDIIRDWMASPPATKVKNE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacccttgagctcgcccggcagctgctgggctttaacaccatcaacccgccg
ggcagcgaagccgactgcatgcggttcttcgccgactggcttgacgatagcggttttgag
gtttcgctgtcgtcgttcggcgaaggacgctgcaatcttatcgccagcctgcccggggcg
aagagcggtaaaccgctggcctttaccggacatctggataccgtcccgctgggaaatgcc
cgctggcagtacgatcctttcggctcgcagatggaagacgggcgtctttatggccgcgga
tccagcgatatgaaagcggcgatagcggcgtttgccgtcgcctgcgttcatcagcgggaa
gcgatcctcgccggacgcggcgcggtattgctgataaccggcggagaagagaccggctgc
gacggcgcgcgggcgctgatcgcctccgcaacgttgccggaggtgggcgcgctgatcgtc
ggtgaacccaccgccaactatccggttatcggccataaaggcgcgctctggctacgctgc
gaaacgcgggggaaaaccgcccacggcgcgatgccggagctggggatcaatgctatttat
cttgcggcggatgcgttgggtaagattcagcatttttcgccaggcgcgccgcatccgcta
atgaagcaacccaccctcaacgtcggacgcatagaaggcggactcaatattaattccgta
ccggaccgcacgcgttttgatgtcgatatccgcagcgcgcccaatttacagcacgccact
atccgggagcgcttgacgacgctgcttggcgaaagcgtcaccgtctccacgctggtcgac
ctgcccgccgtcctcagccgggaggatcatgcgtggattaagcaggtttatcaacgctgt
cagccgctgcacgctgagccgattgcgccgcgcgtggtgccctactttaccgacgcctcg
ctgctgctgcctgcattgggcgatccgccctgtattattctcggccccggcgagccgtcg
atggcgcatcaaaccgacgaatactgcctgctcagccgactggcggaggccgaacagcta
tacggtgacatcattcgcgactggatggcatcaccgcccgcgacgaaagtaaaaaatgag
tga

DBGET integrated database retrieval system