KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_2765Help
Entry
A79E_2765         CDS       T02213                                 

Definition
(GenBank) Phenylacetate degradation enoyl-CoA hydratase PaaA
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00071  Fatty acid degradation
kpp00280  Valine, leucine and isoleucine degradation
kpp00281  Geraniol degradation
kpp00310  Lysine degradation
kpp00360  Phenylalanine metabolism
kpp00362  Benzoate degradation
kpp00380  Tryptophan metabolism
kpp00410  beta-Alanine metabolism
kpp00627  Aminobenzoate degradation
kpp00640  Propanoate metabolism
kpp00650  Butanoate metabolism
kpp00903  Limonene and pinene degradation
kpp00930  Caprolactam degradation
kpp01100  Metabolic pathways
kpp01110  Biosynthesis of secondary metabolites
kpp01120  Microbial metabolism in diverse environments
kpp01130  Biosynthesis of antibiotics
kpp01212  Fatty acid metabolism
Module
kpp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A79E_2765
   00650 Butanoate metabolism
    A79E_2765
  Lipid metabolism
   00071 Fatty acid degradation
    A79E_2765
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A79E_2765
   00310 Lysine degradation
    A79E_2765
   00360 Phenylalanine metabolism
    A79E_2765
   00380 Tryptophan metabolism
    A79E_2765
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A79E_2765
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A79E_2765
   00281 Geraniol degradation
    A79E_2765
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A79E_2765
   00627 Aminobenzoate degradation
    A79E_2765
   00930 Caprolactam degradation
    A79E_2765
Enzymes [BR:kpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A79E_2765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFQ66059
Position
complement(2920871..2921638)
Genome map
AA seq 255 aa AA seqDB search
MSDLLIHRHGRVLQLTLNRPQARNALNNALLTQIAEALEAAAVDDSVGVCVIRGNARFFA
AGADLNEMAEKDLPATLDDIRPRLWARIDAFTKPLIASVNGYALGAGCELALLCDLIVAG
DNARFGLPEITLGIMPGAGGTQRLIRSVGKALASRMVLSGESIDARQAQQAGLVSDIHPA
ALTDEYALKLATTIARHSPLALRAAKQSLRLSQEVSLQAGLQQERQLFSLLSATEDRREG
IDAFLQKRTPEFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacctgctgatccaccgtcatggccgggtgcttcagttgacgctgaaccgcccg
caagcccgcaacgcgctgaacaatgccttattaacccagattgccgaggcgctggaggcc
gcggcagttgatgacagcgtcggcgtctgcgttattcgcggtaacgcgcgttttttcgcc
gccggggctgacctcaatgaaatggcggaaaaagatctgcctgccaccctggatgatatt
cgcccacggttatgggcgcgaatcgatgcttttactaagccgctcatcgcctcggtcaac
ggctacgcgctcggcgccggctgcgagctggctctgctgtgcgacctgattgtcgccggg
gacaacgcccgctttggcctgccggaaattaccctcggcattatgccgggcgcgggcggc
acccagcggctgatccgcagcgttggcaaggcgctggccagccggatggtgctgagcggc
gagagtattgacgcccgccaggcgcagcaggccgggctggtcagtgatatccatccggcg
gcgttaaccgatgagtatgccctgaaactggcaaccaccattgcccgccattcgccgctg
gcgctacgggcggcaaaacagtcgctgcgcctgtcgcaggaagtcagcctgcaggccggt
ctgcaacaggagcgccagctgtttagcctgctgagcgccaccgaggaccgccgcgaaggc
atcgacgccttcttacaaaaacgtaccccggaatttaaaggacgctaa

DBGET integrated database retrieval system