KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_2926Help
Entry
A79E_2926         CDS       T02213                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A79E_2926
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A79E_2926
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A79E_2926
Enzymes [BR:kpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A79E_2926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3095467..3096660
Genome map
AA seq 397 aa AA seqDB search
MSTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPAFQAEFTDLLKNYAGRPTALT
KCRNLTDGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YEKAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIEETNVGLIGVEPAGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTADGQIEESYSI
SAGLDFPSVGPQHAFLNSTGRADYVSITDDEALDAFKALSRHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttactgaacccctacttcggcgaattcggcggcatgtatgtgccgcagatc
ctgatgcccgccctgcgccagctggaagaagcctttgtcagcgcgcagaaggacccggcc
tttcaggcggaattcaccgacctgctgaaaaactacgccggtcgtccgacggccctgacc
aaatgccggaatctgaccgatggcacccgcaccaccctgtacctgaaacgcgaagatctg
ctgcacggcggcgcgcacaaaaccaaccaggtgctgggccaggctctgctggccaaacgg
atgggcaaaaccgaaattatcgccgagaccggcgccggccagcacggcgtcgcctcagcg
ctggccagcgccctgctcggcctgaaatgccgtatctacatgggtgccaaggacgtcgag
cgccagtcgccgaacgtgttccgtatgcgcctgatgggcgccgaggtgatcccggtgcac
agcggctccgccacgctgaaagatgcctgtaacgaggcgctgcgcgactggtccggcagc
tacgaaaaggcgcactatatgctgggcaccgccgccggtccgcacccgttcccgacgatt
gtgcgtgaattccagcgcatgattggcgaagagaccaaagcgcagatccttgaaaaagag
ggccgcctgccggacgcggtgatcgcctgcgtcggcggcggatcaaacgccatcggcatg
ttcgctgattttatcgaggaaaccaacgtcggcctgatcggcgtggagcccgccggacac
ggtatcgagagcggcgagcacggcgcgccgctgaagcatggccgcgttgggatctacttc
ggtatgaagtcgccgatgatgcagaccgccgacggccagatcgaagagtcttactccatt
tccgccgggctggacttcccgtccgttgggccgcagcacgcgtttctgaacagcaccggt
cgcgctgactatgtgtcgatcactgacgacgaagcgctggacgcgtttaaagcgctttcc
cgccacgaagggattatcccggcgctggagtcctctcacgctctggcccacgcgctgaag
atgatgcgcgagaacccggaaaaagagcagctgctggtggttaatctctccggccgcggc
gacaaagacattttcaccgtacatgacatcctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system