KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_2927Help
Entry
A79E_2927         CDS       T02213                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00260  Glycine, serine and threonine metabolism
kpp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kpp01100  Metabolic pathways
kpp01110  Biosynthesis of secondary metabolites
kpp01130  Biosynthesis of antibiotics
kpp01230  Biosynthesis of amino acids
Module
kpp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A79E_2927
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A79E_2927
Enzymes [BR:kpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A79E_2927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFQ66219
Position
3096660..3097469
Genome map
AA seq 269 aa AA seqDB search
MERYETLFAQLKNRQEGAFVPFVTLGDPGPEQSLKIIDALIEGGADALELGIPFSDPLAD
GPTIQGAALRAFAAGVTPAQCFEMLAAIRQKHPTIPIGLLMYANLVFSPGIDAFYAQCAR
VGVDSVLVADVPVEESAPFRQAAMRHNIAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLHHLVEKLAEYHAAPPLQGFGISAPEQVSAAIDAGAAGAISGSAIVKI
IERHLDEPQTMLDELKAFVQSLKAATKTA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatgagacgctgtttgcccaactgaaaaatcgccaggaaggcgccttcgtc
ccctttgtcacccttggcgatccgggaccggagcagtcgctgaaaattatcgatgcgctg
atcgaaggcggcgccgatgcccttgaactggggatccctttctccgacccgctggcggac
ggcccgaccatccagggcgcggccctgcgcgccttcgccgcgggagtgaccccagcgcag
tgctttgagatgctggcggcgatccgccagaagcatccgaccatcccaatcggcctgctg
atgtatgccaacctcgtcttcagcccgggcatcgatgcgttctatgcccagtgcgcccgc
gtcggcgtcgactcggtgctggtggccgacgtgccggtggaagagtccgccccgttccgc
caggcggcgatgcgccataacatcgcgccgattttcatctgcccgcccaatgcggatgac
gatttactgcgccagattgcctcttatggccgcggctacacctatctgctgtcgcgcgcc
ggagtgacgggtgcggaaaatcgcgccgcgctgccgctgcaccacctggtggagaagctg
gcggaatatcacgccgcgccgccgctgcagggctttggtatctccgcgccggagcaggtg
agcgccgccattgacgccggagccgccggggctatctccggttccgccatcgtcaaaatc
atcgaacgccacctcgatgagccgcagaccatgctcgacgagctgaaagccttcgtccag
agcctgaaggcagcgaccaaaaccgcctga

DBGET integrated database retrieval system