KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_2991Help
Entry
A79E_2991         CDS       T02213                                 

Definition
aldose 1-epimerase family protein YeaD
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A79E_2991
Enzymes [BR:kpp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     A79E_2991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3161642..3162526
Genome map
AA seq 294 aa AA seqDB search
MINKIFALPVNETISPVISRRQLDDLELIVIDHPQVKASVALQGAHLLSWKPAGEEEVLW
LSNNTPFKQGVALRGGVPICWPWFGPSAQQGLPSHGFARNLPWTLEGHDEDDSGVMLTFA
LQHSAETMKLWPHEFTLYARFKLGKTCEIELEAHGEFETTSALHSYFNVGDIAAVKVSGL
GERYIDKVNNAEEGVLSNGVQTFPDRTDRVYLNADSCSVIHDDALNRTIDVVHHHQHNVV
AWNPGPALSVSMGDMPDDGYKTFVCVETCCVTQPQKASEETPSRLAQTISVKKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaaatttttgctctcccggtgaatgaaaccatttctcccgtgatctcccgt
cgccagctggacgacctggagctgattgtcatcgaccatccgcaggtgaaagcctctgtg
gcgctgcagggggcgcacctgctctcctggaaacccgccggtgaagaagaagttctgtgg
ctgagcaacaacaccccgtttaaacagggcgtcgccctgcgcggcggcgtgccgatttgc
tggccctggtttggtccttctgcgcagcaaggtctgccgtcgcacggctttgcccgcaat
ctgccatggaccctggaaggtcatgacgaagacgacagcggcgtaatgttgacctttgcg
ctccagcacagcgctgaaaccatgaagctctggccgcacgagttcaccctctatgcccgc
tttaagctgggcaagacctgtgaaatcgagctggaagcccacggtgaattcgagaccacc
tctgccctgcacagctatttcaacgtcggcgatatcgcggcggtgaaggtgagcggtctt
ggcgagcgctatatcgataaagtgaacaatgccgaagaaggcgttctgagcaacggcgtg
cagaccttcccggaccgcaccgatcgcgtctatctcaacgccgacagctgcagcgtgatc
catgacgacgcgctaaaccgcactatcgacgtggtgcatcatcatcagcacaatgtggtg
gcctggaacccgggcccggcgctgtccgtcagcatgggcgatatgccggacgatggctac
aaaaccttcgtttgcgtcgaaacctgctgcgtaacccagccgcagaaagccagcgaagag
acgccctctcgcctggcgcaaaccatcagcgtgaaaaaacgctaa

DBGET integrated database retrieval system