KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_3126Help
Entry
A79E_3126         CDS       T02213                                 

Definition
beta N-acetyl-glucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kpp00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:kpp00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3312203..3313213)
Genome map
AA seq 336 aa AA seqDB search
MLDVEGYELDAEEREILAHPLVGGLILFTRNYHDLAQLRELVRQIRDASRNHLVVAVDQE
GGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAAEAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHEDPQKALTMARHFIDGMHAAGMKTTGKHFPGHGAVTADSHKETPFDPR
AASVIRDHDMAVFKSLIAEQRLDAIMPAHVIYPELDPRPASGSAYWLKTVLRGELGFDGV
IFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERVTKLY
HKGSFSRQELRDSARWKTVSAQLEQLHARWQEAKSA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtcgaagggtatgagctggatgcggaagagcgagaaattctggcgcatccg
ctggtgggagggttgatcctctttacccgaaattatcacgatctggcgcagctgcgcgag
ctggtgcgccagatccgcgacgcctcccggaaccacctggtggtggcggtcgatcaggaa
ggggggcgggttcagcgtttccgcgaagggtttacccgtttaccggcggcccagtctttc
gccgcgctgctggggatggaagaggggggcaaactggccgccgaagccggctggctgatg
gccagcgaaatgatcgccatggatatcgatattagttttgcgccagtgctggacgtcggc
catatcagcgccgcaatcggcgaacgttcttatcatgaagatccacagaaagcgctgacg
atggcgcgtcacttcattgacgggatgcacgccgcgggcatgaaaaccaccggcaaacac
ttcccgggtcacggggcggtgactgccgattcgcacaaagagacgccgttcgatccgcgg
gcggcatcggttatccgcgaccatgatatggcggtgttcaaaagccttatcgccgagcag
cgtctggatgccattatgccggcgcatgtgatttacccggagctcgatccgcgtccggcc
agcggctcggcgtactggctgaaaacggtgctgcgcggcgaactgggctttgacggggtg
attttctccgacgatctgtcgatggaaggggcggcgatcatgggcagctatgccgaacgc
ggtcaggcatcgctcgacgccggttgcgatatgatcctcgtctgcaataatcgtaaaggc
gcggtcagtgtgctggataacctgtcgccgatcaaagcagagcgtgttacgaaattgtat
cataaaggttccttttcccgtcaggagttaagggattcagcccgttggaaaacggtgagt
gcccagctggagcagcttcatgcgcgctggcaagaggcgaagtccgcgtaa

DBGET integrated database retrieval system