KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_3126Help
Entry
A79E_3126         CDS       T02213                                 

Definition
beta N-acetyl-glucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A79E_3126
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    A79E_3126
Enzymes [BR:kpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     A79E_3126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3312203..3313213)
Genome map
AA seq 336 aa AA seqDB search
MLDVEGYELDAEEREILAHPLVGGLILFTRNYHDLAQLRELVRQIRDASRNHLVVAVDQE
GGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAAEAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHEDPQKALTMARHFIDGMHAAGMKTTGKHFPGHGAVTADSHKETPFDPR
AASVIRDHDMAVFKSLIAEQRLDAIMPAHVIYPELDPRPASGSAYWLKTVLRGELGFDGV
IFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERVTKLY
HKGSFSRQELRDSARWKTVSAQLEQLHARWQEAKSA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtcgaagggtatgagctggatgcggaagagcgagaaattctggcgcatccg
ctggtgggagggttgatcctctttacccgaaattatcacgatctggcgcagctgcgcgag
ctggtgcgccagatccgcgacgcctcccggaaccacctggtggtggcggtcgatcaggaa
ggggggcgggttcagcgtttccgcgaagggtttacccgtttaccggcggcccagtctttc
gccgcgctgctggggatggaagaggggggcaaactggccgccgaagccggctggctgatg
gccagcgaaatgatcgccatggatatcgatattagttttgcgccagtgctggacgtcggc
catatcagcgccgcaatcggcgaacgttcttatcatgaagatccacagaaagcgctgacg
atggcgcgtcacttcattgacgggatgcacgccgcgggcatgaaaaccaccggcaaacac
ttcccgggtcacggggcggtgactgccgattcgcacaaagagacgccgttcgatccgcgg
gcggcatcggttatccgcgaccatgatatggcggtgttcaaaagccttatcgccgagcag
cgtctggatgccattatgccggcgcatgtgatttacccggagctcgatccgcgtccggcc
agcggctcggcgtactggctgaaaacggtgctgcgcggcgaactgggctttgacggggtg
attttctccgacgatctgtcgatggaaggggcggcgatcatgggcagctatgccgaacgc
ggtcaggcatcgctcgacgccggttgcgatatgatcctcgtctgcaataatcgtaaaggc
gcggtcagtgtgctggataacctgtcgccgatcaaagcagagcgtgttacgaaattgtat
cataaaggttccttttcccgtcaggagttaagggattcagcccgttggaaaacggtgagt
gcccagctggagcagcttcatgcgcgctggcaagaggcgaagtccgcgtaa

DBGET integrated database retrieval system