KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_3450Help
Entry
A79E_3450         CDS       T02213                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A79E_3450
   00500 Starch and sucrose metabolism
    A79E_3450
Enzymes [BR:kpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     A79E_3450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3670398..3671681
Genome map
AA seq 427 aa AA seqDB search
MNTYSVSRLALALAFGVTLSACSSTPADQQPSTQTAPGTTARPILNAEEAKNFTPAAYFQ
SLTPNAAAWTPSAISLPAQPDFIVGPAGTQGVTHTTIQAAVDAAIARHSNRRLYIAIMPG
EYPGTVYVPAAPGALTLYGTGDKPIDVKISEAIDSEMDRNTWRRLVNPGGKYMPGKPAWY
MFDSCQSKSAATVGVMCSAVFWSQNNGLQLQNLTIANNLGDSVDAGTHQAVALRSDGDQV
QINKVNILGRQNTFFVTNSGVQNRLQDNRQTRTLVTNSYIEGDVDIVSGRGAVVFDNTDF
RVVNSRTQKEAYVFAPATLKSVTYGFLATNSRFTASGDNVAQLGRALDVDGNSNGQVVIR
DSAINEGFNIAQPWAAAVGSGRPFSGNTGSADDKGNLQRNLNDNGFNRMWEYNNRGVGST
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatattccgtttcccgtctggcgctggcgctggccttcggcgtgacgctgtcc
gcctgtagctcgacgcctgccgatcaacagccctcaacgcagactgcaccgggcactacc
gcgcgtcccatactcaacgccgaagaagcgaaaaacttcacgccggcggcctatttccag
tcgctgactcccaacgccgccgcctggacgccgtctgctatcagcctgccggcgcagcct
gactttatcgtcggccctgcgggaacccagggcgtaacccataccaccattcaggcggcg
gtggatgcggcaattgcccgtcactctaaccgtcgtctgtatatcgcgattatgccgggc
gagtacccgggaaccgtctacgttccggcggcgccgggcgccctgaccctgtatggtact
ggcgataagccaatcgacgtgaaaatcagcgaagccattgattccgagatggatcgcaac
acctggcgtcgtctggtcaatccaggcggtaaatatatgccgggtaaaccggcgtggtat
atgttcgacagttgccaaagcaaatccgcggcgaccgtcggcgtaatgtgttccgcagtc
ttctggtcacagaataatggtctgcagctgcagaacctgaccatcgccaacaacctcggc
gacagcgttgacgccggtacccaccaggcggtggcattgcgcagcgatggcgaccaggtg
cagatcaataaggtcaatattcttggccgtcagaacaccttcttcgtgaccaacagcggc
gtgcaaaaccgtctgcaggacaaccgtcagacccgcaccctggtgaccaacagctacatt
gaaggcgatgtggatatcgtttccggccgcggcgcggtggtgtttgataacaccgatttc
cgcgtggtgaactcccgtacccagaaagaggcctacgtcttcgcgccggctactctgaag
agcgtgacctacggcttcctggcgaccaacagccgcttcaccgcctccggggataacgtc
gcgcagctcggccgcgcgctggacgtcgatggcaacagcaacggccaggtggtgatccgc
gacagcgctatcaatgaaggctttaatattgcccagccgtgggcggcggcggtaggctcc
ggccgcccgttcagcggcaacaccggcagcgccgatgacaaaggcaatctgcagcgcaac
ctcaacgacaacggcttcaaccgcatgtgggagtacaataaccgcggcgtgggaagcacc
gtggtcgccgagccgaaacagtaa

DBGET integrated database retrieval system