KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_3507Help
Entry
A79E_3507         CDS       T02213                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00020  Citrate cycle (TCA cycle)
kpp00190  Oxidative phosphorylation
kpp00650  Butanoate metabolism
kpp01100  Metabolic pathways
kpp01110  Biosynthesis of secondary metabolites
kpp01120  Microbial metabolism in diverse environments
kpp01130  Biosynthesis of antibiotics
kpp01200  Carbon metabolism
Module
kpp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kpp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A79E_3507
   00650 Butanoate metabolism
    A79E_3507
  Energy metabolism
   00190 Oxidative phosphorylation
    A79E_3507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C CbtB
Motif
Other DBs
NCBI-ProteinID: AFQ66770
Position
complement(3724399..3724746)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATTGEISWEVWTGFFASGFTKVF
TLLALVSILIHAWIGMWQVLTDYVKPLALRLVLQLAIVVALVAYVLYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctcagcactgggacgcaacggcgtacatgactttatcctggtccgt
gctaccgccatcgttctgaccctctacatcatctacatggttggcttcttcgccaccacc
ggtgaaatctcatgggaagtgtggaccggattctttgcctccggcttcactaaggtcttc
actctgctggctctcgtttccattctcatccatgcctggatcgggatgtggcaggtgtta
acggactacgttaaaccactggctctgcgcctggttctgcaactggctatcgttgtggcg
ctggtggcttacgttctttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system