KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_3543Help
Entry
A79E_3543         CDS       T02213                                 

Definition
Asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:kpp00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3762029..3763693
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDIKTDAGELRKKALELSRLMRHRGPDWSGVYASDKAILAHERLSIVDVNAGA
QPLYNAEKTHALAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHIGIIPLYMGHDEHGNFYVASEMKALVPVCRTIKEFPAGSY
LWSKDGEIRQYYQRDWFDYDAVKDNVTDKNELRQALEESVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDQERSEAWWPQLHSFAVGLEGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLQALHMFDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLET
ASFRFPYNTPTSKEGYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKTMND
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctatttttggcgtactggatattaaaactgacgcaggcgagctgcgtaaaaag
gcgctggagctttcccgcctgatgcgccaccgcggtccggactggtctggcgtatatgcc
agcgacaaagcgattctggcgcacgagcgcctgtcgattgtcgacgtcaacgccggggcc
cagccgctgtacaacgccgaaaaaacccatgcgctggccgttaacggcgagatctacaac
caccaggcgctgcgcgcggagtatggcgatcgctaccagttccagaccggttccgactgc
gaagtgatcctcgcgctgtatcaggaaaaaggcccggagttcctcgacgatctgcaggga
atgttcgccttcgccctgtacgacagcgaaaaagacgcgtacttaattggccgcgaccat
atcggcattatcccgctgtatatgggccatgacgaacacggcaacttctatgtcgcctcc
gaaatgaaagcgctagtgccggtatgccgcaccattaaagagttcccggcgggcagctac
ctgtggagcaaagacggcgaaattcgccagtactatcagcgcgactggtttgattacgac
gcggtgaaagacaacgttaccgataagaacgagctgcgccaggcgctggaagagtcggtg
aaaagccacctgatgtccgacgtgccttacggcgtgctgctctccggcggtcttgattca
tcggtcatctcggctatcaccaagaaattcgccgcccgtcgcgtcgaagatcaggagcgt
agcgaagcctggtggccgcagctgcactctttcgcggtcggtctggaaggctctcctgac
ctgaaagcggcgcaggaggtggccaaccacctcggcaccgtgcaccacgaaattcacttt
accgtccaggaagggctggatgccatccgcgacgttatctatcacatcgaaacctacgat
gtgaccactattcgcgcctcgacgccgatgtacctgatgtcgcggaaaattaaagccatg
ggcatcaaaatggtgctttccggcgaaggttcggacgaagtgttcggcggctacctctac
ttccataaggcgccgaacgccaaagaactgcacgaagagacggtgcgtaagctgcaggcg
ctgcatatgtttgactgcgcccgcgccaacaaagcgatgtccgcctggggcgtggaggcc
cgcgtgccgttcctcgacaagaagttcctcgacgtcgcgatgcgcattaacccgcaggat
aagatgtgcggcaacggcaaaatggaaaaacacattctgcgcgaatgctttgaatcctac
ctgccggccagcgtcgcctggcgccagaaggagcagttctctgacggcgtcggctacagc
tggatcgataccttgaaagaagtggccgccaaacagatcagcgaccagcaactggaaacc
gcaagcttccgcttcccgtacaacacgccgacctccaaagaaggctatctgtaccgcgag
atcttcgaagagctgttcccgctgccgagcgcggcggagtgcgtccctggcggtccgtcg
gtggcctgctcttcagcgaaagccattgagtgggatgaagcgttcaaaaccatgaacgat
ccatcaggccgcgcggtcggtgtccaccagtcggcctacaaataa

DBGET integrated database retrieval system