KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_3597Help
Entry
A79E_3597         CDS       T02213                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A79E_3597
Enzymes [BR:kpp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     A79E_3597
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     A79E_3597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3810918..3811460
Genome map
AA seq 180 aa AA seqDB search
MSALTLFSVTDPQTPVWHSTDAKAIQDQLNAKGVRFERWQADRDLGANPSPETVIAAYQH
AIDKLVAEKGYQSWDVISLRADNPQKEALREKFLNEHTHGEDEVRFFVEGAGLFCLHIGD
EVFQVLCEKNDLISVPAHTPHWFDMGSEPNFTAIRIFDNPEGWIAQFTGDDIASAYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattaactcttttttccgtgaccgatccgcaaacgccggtctggcacagcacc
gacgccaaagcgattcaggatcaacttaacgccaaaggcgtccgtttcgagcgctggcag
gccgaccgcgacctcggcgcaaatcccagcccggaaacggtgattgccgcctatcagcat
gcgattgataaactggtcgccgaaaagggctaccaaagctgggacgtcatcagcctgcgc
gccgataacccgcaaaaagaggcgctgcgggaaaagttcctgaacgagcacacccatggc
gaagacgaggtccggttttttgtcgagggcgctggcctgttttgcctgcacattggcgac
gaggtgttccaggtgctgtgcgaaaagaacgatctgatttcggttcccgcccacactccg
cactggtttgatatgggatcagaaccgaacttcaccgccattcgcatttttgataacccg
gaaggctggatcgctcagtttaccggcgacgatatcgccagcgcctacccgcggctggcg
taa

DBGET integrated database retrieval system