KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_3643Help
Entry
A79E_3643         CDS       T02213                                 

Definition
pentose kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:kpp00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3867426..3868946
Genome map
AA seq 506 aa AA seqDB search
MQATAKEFIIALDEGTTNAKAVVLDSRGKVIVKFSQPLAIQTPRDGWVEQSGEALVTASL
AVIASAVAHVGAENVAALAISNQRETAIGWYRDSGEPINAAITWQCTRSAAFCDTLRHDR
QEQRIKQATGLPIAPLFSASKMRWLLDATADGRLRAERGEICLGTIDSWLLWNLTAGEAF
CCDYSNAARTQLLNLHRGEWDDEMLALFGIPRAALPDIKSSSGLFGHTKGLAAIPDGIPI
MAMIGDSHAALFGHALGEAGCVKATYGTGSSVMAPVKSAQCDIDALATTVAWHDGDQLVW
GLEGNIPHTGDAVAWMADSTGLSELSAAELAHELNTLPASVDSTLGVYFVPALTGLGAPW
WDDSARGVICGLSRGVKRAHLIRAALESITYQIADVVVAMRQHEEFTLTALMVDGGPTNN
DWLMQYQADLLGCPVMRSDVPELSAIGAALLARKALHPGSTADLQAFLTEHSTFQPDMAR
HQRLQTRWQEWRHAVDRTLWKPDSPA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgacagcaaaagagttcatcattgccctggatgaaggcaccaccaacgccaaa
gcggtggtgctggatagccggggcaaggttatcgtcaaattctcgcagccgctggcgatc
caaacgccgcgcgacggctgggtggagcaatcgggcgaagcgctggttaccgcctcgctg
gcggtgatcgccagcgcggtggcccacgttggcgcggaaaacgtcgccgcgctggccatc
agcaaccagcgggaaaccgccatcggctggtatcgcgacagcggcgaaccgattaacgcg
gcgatcacctggcaatgcacccgcagcgccgcgttctgcgatacgctgcgtcacgatcgt
caggaacagcgtattaaacaggccaccggcctgccgatcgccccgctattctcggcctcc
aaaatgcgctggctgctggatgcgactgcggatggccgcctgcgcgccgaacgcggcgaa
atttgcctcggcaccatcgacagctggctgctgtggaatctgactgctggagaagccttc
tgctgcgactactccaatgccgcccgcacccagctgctgaacctgcaccgcggcgagtgg
gacgacgagatgctggcgctgttcggcattccgcgcgcggcgttgccggacattaaatca
tcgagcggcctcttcggccataccaaaggactggccgccattccggacggtattccgatc
atggcgatgatcggcgactcccacgcggcactgttcggccacgcgctcggcgaggcaggc
tgcgtcaaagccacctacggcaccggctcttcggtcatggccccggtcaaatcggcgcag
tgcgatatcgacgcgctggcgaccactgtcgcctggcacgatggcgaccagctggtgtgg
ggcctggaagggaatattccccacaccggcgatgctgtcgcctggatggcggacagcacc
ggactgagcgaactctctgccgccgagctggcccatgagctgaataccctccccgcctcc
gtcgattcaaccctcggggtctacttcgtgccggcgctgaccggtcttggcgcgccctgg
tgggacgacagcgcccgcggcgtgatttgcggcctgagtcgcggggtgaaacgcgcgcat
ctgatccgtgcggcgctggagtccatcacctatcagatagccgacgtggtggtggcgatg
cgtcagcatgaggagttcaccctgacggcgttgatggtggacggcgggccgaccaacaat
gactggctgatgcaataccaggccgatctgctcggctgcccggtgatgcgcagcgacgtg
ccggagctgtccgccatcggcgcggcgttgctggcgcgcaaagcgctccatccggggtcg
accgccgatctgcaggccttcttaaccgaacacagcacctttcagcccgacatggcccgc
caccagcgtttacaaacgcgctggcaggagtggcgccatgcggtcgaccgaacattatgg
aaaccggactcgccagcctga

DBGET integrated database retrieval system