KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_3643Help
Entry
A79E_3643         CDS       T02213                                 

Definition
pentose kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    A79E_3643
Enzymes [BR:kpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     A79E_3643
Exosome [BR:kpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A79E_3643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3867426..3868946
Genome map
AA seq 506 aa AA seqDB search
MQATAKEFIIALDEGTTNAKAVVLDSRGKVIVKFSQPLAIQTPRDGWVEQSGEALVTASL
AVIASAVAHVGAENVAALAISNQRETAIGWYRDSGEPINAAITWQCTRSAAFCDTLRHDR
QEQRIKQATGLPIAPLFSASKMRWLLDATADGRLRAERGEICLGTIDSWLLWNLTAGEAF
CCDYSNAARTQLLNLHRGEWDDEMLALFGIPRAALPDIKSSSGLFGHTKGLAAIPDGIPI
MAMIGDSHAALFGHALGEAGCVKATYGTGSSVMAPVKSAQCDIDALATTVAWHDGDQLVW
GLEGNIPHTGDAVAWMADSTGLSELSAAELAHELNTLPASVDSTLGVYFVPALTGLGAPW
WDDSARGVICGLSRGVKRAHLIRAALESITYQIADVVVAMRQHEEFTLTALMVDGGPTNN
DWLMQYQADLLGCPVMRSDVPELSAIGAALLARKALHPGSTADLQAFLTEHSTFQPDMAR
HQRLQTRWQEWRHAVDRTLWKPDSPA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgacagcaaaagagttcatcattgccctggatgaaggcaccaccaacgccaaa
gcggtggtgctggatagccggggcaaggttatcgtcaaattctcgcagccgctggcgatc
caaacgccgcgcgacggctgggtggagcaatcgggcgaagcgctggttaccgcctcgctg
gcggtgatcgccagcgcggtggcccacgttggcgcggaaaacgtcgccgcgctggccatc
agcaaccagcgggaaaccgccatcggctggtatcgcgacagcggcgaaccgattaacgcg
gcgatcacctggcaatgcacccgcagcgccgcgttctgcgatacgctgcgtcacgatcgt
caggaacagcgtattaaacaggccaccggcctgccgatcgccccgctattctcggcctcc
aaaatgcgctggctgctggatgcgactgcggatggccgcctgcgcgccgaacgcggcgaa
atttgcctcggcaccatcgacagctggctgctgtggaatctgactgctggagaagccttc
tgctgcgactactccaatgccgcccgcacccagctgctgaacctgcaccgcggcgagtgg
gacgacgagatgctggcgctgttcggcattccgcgcgcggcgttgccggacattaaatca
tcgagcggcctcttcggccataccaaaggactggccgccattccggacggtattccgatc
atggcgatgatcggcgactcccacgcggcactgttcggccacgcgctcggcgaggcaggc
tgcgtcaaagccacctacggcaccggctcttcggtcatggccccggtcaaatcggcgcag
tgcgatatcgacgcgctggcgaccactgtcgcctggcacgatggcgaccagctggtgtgg
ggcctggaagggaatattccccacaccggcgatgctgtcgcctggatggcggacagcacc
ggactgagcgaactctctgccgccgagctggcccatgagctgaataccctccccgcctcc
gtcgattcaaccctcggggtctacttcgtgccggcgctgaccggtcttggcgcgccctgg
tgggacgacagcgcccgcggcgtgatttgcggcctgagtcgcggggtgaaacgcgcgcat
ctgatccgtgcggcgctggagtccatcacctatcagatagccgacgtggtggtggcgatg
cgtcagcatgaggagttcaccctgacggcgttgatggtggacggcgggccgaccaacaat
gactggctgatgcaataccaggccgatctgctcggctgcccggtgatgcgcagcgacgtg
ccggagctgtccgccatcggcgcggcgttgctggcgcgcaaagcgctccatccggggtcg
accgccgatctgcaggccttcttaaccgaacacagcacctttcagcccgacatggcccgc
caccagcgtttacaaacgcgctggcaggagtggcgccatgcggtcgaccgaacattatgg
aaaccggactcgccagcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system