KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_3744Help
Entry
A79E_3744         CDS       T02213                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A79E_3744
   00500 Starch and sucrose metabolism
    A79E_3744
Enzymes [BR:kpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     A79E_3744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3976378..3977778
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPQALADSHYPQWHLAPVNGLLNDPNGFCQVAGRYHLFYQWNP
LACDHTYKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSAVEFEGALTLCYTGNVK
FPDGGRTAWQCLATENADGTFRKLGPVLPLPEGYTGHVRDPKVWRQDGRWYMVLGAQDVQ
QRGKVLLFTASDLREWRLVGEIAGHDVNGLANAGYMWECPDLFPLADTHLLICCPQGLAR
EAQRFLNTYPAVWMAGRFDAERGIFDHGPLHELDSGFEFYAPQTMQAKDGRRLLVGWMGV
PDGEEMHQPTRAQGWIHQMTCVRELEWQAGTLYQRPLRELAALRGEAQGWRGQTLPLAPM
ELAFDLSPDSTLGLDFAGALQLTVNRDGLRLSRRGLQTAEMHHRYWRGEARRLRIFIDRS
SVEIFINDGEGVMSSRFFPGYPGQLIFSGATPVAFCRWLLRPCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccgtcacgcctgcctgcgatcctgcaggccgttatgcagggccagccgcag
gcgctggccgacagccattatccgcaatggcatctggcgccggtcaacggactgctgaac
gatcctaacggcttttgccaggtcgccgggcgttaccacctgttttatcagtggaacccg
ctcgcctgcgaccatacctataagtgctggggacactggagctctgccgatctgctgcac
tggcggcacgaacctatcgccctgatgccggatgaagagtatgaccgcaacggctgctac
tctggcagcgcggtcgagttcgagggcgccctgactctgtgctacaccggcaacgtgaaa
ttccccgacggcgggcgcaccgcctggcaatgtctggcgaccgagaatgccgatggcacc
ttccgcaagctggggccggtgctgccgctgccagaaggctataccggccatgtgcgcgac
cctaaagtgtggcggcaggacgggcgctggtacatggttcttggggcgcaggatgtgcaa
cagcgcggcaaagtgctgctgtttaccgccagcgacctgcgggagtggcgcctggtaggg
gagatcgccgggcacgacgtgaacggcctggcgaacgccggctacatgtgggagtgcccg
gatctctttccgctggcggacacccacctgctgatctgctgcccgcaggggctggcccgc
gaagcgcagcgctttctcaatacctatccggcggtatggatggcaggccgcttcgacgcc
gaacgcgggatcttcgaccacggcccgctgcacgagctggacagcggatttgagttctac
gcgccgcagaccatgcaggcaaaagatggccgccgcctgctggtcggctggatgggcgtc
cccgacggggaagagatgcatcagcccacccgcgcgcagggctggatccatcagatgacc
tgcgtgcgtgagctggagtggcaggctggcactctgtatcagcgtccgctgcgcgagctg
gccgctctgcgcggggaagcccagggctggcgcgggcagaccctgcccctcgccccgatg
gagctggcctttgacctttcccccgacagcacgctggggctggactttgccggcgccctg
cagctcaccgtcaatcgcgacggcctacgtctgtcgcgccgcggcctgcagacggcagag
atgcatcaccgctactggcgcggcgaggcgcgacgcctgcggatctttatcgaccgctcc
agcgtggagattttcatcaacgatggcgagggggtgatgagcagccgcttcttcccgggc
tatccggggcagctcatcttcagcggtgcgacgccggtggcattctgccgctggctgctg
cggccatgcatggtagaataa

DBGET integrated database retrieval system