KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_3808Help
Entry
A79E_3808         CDS       T02213                                 

Definition
Arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    A79E_3808
Enzymes [BR:kpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     A79E_3808
   3.1.2  Thioester hydrolases
    3.1.2.-  
     A79E_3808
Lipid biosynthesis proteins [BR:kpp01004]
 Fatty acid synthase
  Component type
   A79E_3808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4047794..4048420
Genome map
AA seq 208 aa AA seqDB search
MMNFKYVFRWHVPFLLLFLFTCRAMAADTLLILGDSLSAGYRMAANAAWPALLNEQWQAK
TPVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFPPQQTEQTLRTIIKD
IKAANAEPLLMQIHLPANYGRRYNEAFGAIYPALAKEFAIPLLPFFMEEVYLKPQWMQDD
GIHPNRDAQPFIADWMAKRLAPLVNHDS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaagtatgttttccgctggcatgtgcctttcctgttgttgttcctgttt
acctgccgcgcgatggcggcggacacgctgctgatcctcggcgacagcctgagcgctggc
tatcggatggcggccaacgccgcctggcctgcgctgctcaatgagcagtggcaggcgaaa
acgccggtggtgaacgccagcatcagcggcgatacctcgcagcaggggttggctcgcctg
ccagcgctgcttaagcagcaccagccgcgctgggtgctggttgagctcggcggcaatgac
ggactgcgcggttttccgccgcagcagaccgagcagacgctgcgcaccattattaaagat
atcaaagcggccaacgccgagccgctgctgatgcaaattcacctgccggcgaactatggc
cgccgctataatgaagccttcggcgcgatttacccggccctggccaaagagttcgctatt
cctctcctgcccttttttatggaggaggtctatctcaagccgcaatggatgcaggacgac
ggcattcatccaaatcgcgacgcgcagccgtttatcgccgactggatggcgaagcggctg
gctcccttagttaatcatgactcctga

DBGET integrated database retrieval system