KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4009Help
Entry
A79E_4009         CDS       T02213                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kpp01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kpp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4249003..4250106
Genome map
AA seq 367 aa AA seqDB search
MSESQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAMGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNSIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQPGLFTADPR
SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIAAGNRPD
VIGHAMAGLPVGTCFHAQESPLENRKRWIFGAPPAGEITVDAGATQAILERGSSLLPKGI
KIVSGNFSRGEVIRIRNSEGRDIAHGVSRYNSDALRLIAGQHSQQIDAILGYEYGPVAVH
RDDMIIR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagccagacgctggtggtaaaactgggcaccagtgttttaacaggcgggtcc
cgtcgcctgaaccgcgcccatatcgtcgagcttgtgcgccagtgcgcacagttgcacgcc
atgggacaccgtattgtcatcgtgacctccggggccattgccgccgggcgcgagcacctt
ggttacccggaactgcccgccaccatcgcctccaagcagctgctggcggcggtgggacaa
agccgtctgatccagctgtgggaacagctgttttctatctatggcattcacgttggccag
atgctgctgacccgcgccgacatggaagacagagaacggttcctcaacgcccgcgacact
ctgcgcgcgctgctggataacagcatcgtcccggtcattaacgaaaacgacgccgtcgcc
accgcggaaatcaaagtgggcgataacgacaatctctccgcgctggccgcgatcctcgcc
ggggcggataagctgctgctgttaaccgaccagccaggcctgttcaccgccgacccgcgc
agcaacccgcaggcggagctgattaaagacgtctacggcatcgacgacgcgctgcgcgcc
atcgccggcgatagcgtctccggactcggcaccggcggcatgggcaccaagctgcaggcc
gcggacgtcgcctgccgcgcggggattgataccatcatcgccgcaggcaaccgtccggac
gtcatcggccatgcgatggcaggcctgccggtaggtacctgcttccacgcccaggagtct
ccgctggagaaccgtaagcgctggatcttcggcgcgccgccggcgggggaaatcaccgtc
gatgcgggcgcgacccaggcgatcctcgaaagaggcagctcgctgttgccaaaagggatc
aaaatcgtcagcggcaacttctcccgcggcgaagtgatccgcatccgcaatagcgaagga
cgcgacatcgctcacggcgtcagccgctacaacagcgatgcgctgcgccttatcgccggc
cagcactcgcagcaaatcgatgccattctgggctatgaatacggcccggtggccgtccac
cgcgatgatatgatcatccgttaa

DBGET integrated database retrieval system