KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4154Help
Entry
A79E_4154         CDS       T02213                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A79E_4154
Enzymes [BR:kpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     A79E_4154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4400820..4401299
Genome map
AA seq 159 aa AA seqDB search
MTLVYIALGSNLASPLEQAQAAIRALGEIPHSRVVAVSSFYRTPPLGPQDQPDYLNAAVA
LETALPPETLLDHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDAVINSERLTVPHYDMK
NRGFMLWPLFEIAPDLHFPDGLALRAVLDNLGAEKPASW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggtctatatcgctcttggcagcaaccttgcttctccactggagcaggcgcag
gcggctatccgcgccctgggcgaaattccgcacagccgcgtggtcgccgtctcttcgttc
taccgcacgccgccgctgggcccgcaggatcagccggactatctcaacgccgccgttgcg
ctggaaaccgccctgccccccgagacgctgctcgatcatactcagcgcatcgaactgcag
caggggcgagtgcgcaaagccgaacgctgggggccgcgcacgctggacctcgatatcatg
ctgtttggcgatgctgtcattaacagcgagcgcctgaccgttccgcactacgatatgaaa
aaccgcggctttatgctctggccgctgttcgagatcgccccggaccttcactttcctgac
ggcctggcgctgcgcgccgtgctggataatctcggcgcggaaaagcccgccagctggtaa

DBGET integrated database retrieval system