KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4212Help
Entry
A79E_4212         CDS       T02213                                 

Definition
murE
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    A79E_4212
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A79E_4212
Enzymes [BR:kpp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     A79E_4212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4461773..4463188)
Genome map
AA seq 471 aa AA seqDB search
MTLDSRVAASGDLFIAVQGHQADGRRYIPQAIAQGVAAIIAEAQGEAKDGEIREMHGVPV
IYLSQLNERLSALAGRFYHQPSQQLRLVGVTGTNGKTTTTQLLAQWAKLLGETSAVMGTV
GNGLLDKVVPTENTTGSAVDVQHVLSSLVGQGATFGAMEVSSHGLVQHRVAALQFAASVF
TNLSRDHLDYHGDMEHYEAAKWLLYSTHHCGQAIVNADDEVGRRWLAKLPDAVAVSMEDH
INPNCHGRWLKATAVNYHDSGATIQFDSSWGKGEIESRLMGAFNVSNLLLALATLLALGY
PLADLLKTAARLQPVCGRMEVFSAPGKPAVVVDYAHTPDALEKALQAARLHCSGKLWCVF
GCGGDRDKGKRPLMGAIAEEFADIVVVTDDNPRTEEPRAIINDILAGMLDAGQAKVMEGR
AEAVTNAVMQAKENDVVLVAGKGHEDYQIVGNRRLDYSDRVTVARLLGAVA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggacagccgggtggctgcttccggcgatctctttatcgcggtacagggtcat
caggcggacgggcgtcgttatatcccgcaggcgatagcgcaaggtgtggctgccattatt
gctgaagcgcagggcgaagctaaagacggtgagatccgtgaaatgcacggcgtgccggtt
atctacctgagccagcttaacgaacgcttatcggcgctggccgggcgtttttatcatcag
ccgtcgcagcagctgcgtctggtgggcgtcaccggcaccaacgggaaaaccaccaccact
cagctgctggcgcagtgggcaaagctgctcggcgaaaccagcgcggtgatggggaccgtc
ggtaacggtctgctggataaagtcgttccaactgaaaacaccaccggttccgcggtggac
gttcaacatgtgctctccagtctggtcgggcagggggctaccttcggcgcgatggaagtc
tcctcccatggtctggtacagcaccgcgtagcggccctgcagtttgccgcctcggtgttt
accaatctcagccgcgatcatctcgactaccatggcgacatggagcactacgaagcggcg
aaatggctgctgtactccacccatcattgcggtcaggccatcgtcaatgctgacgatgaa
gtcggtcgtcgctggctggcaaaactgccggacgcggtggcggtatcgatggaagatcat
atcaacccgaattgccacggccgctggctaaaggccaccgcggtgaactatcacgacagc
ggggcgaccatccagtttgactccagctggggcaagggcgaaatcgaaagccgcctgatg
ggcgcatttaacgtcagcaacctgctgctggcgctggccacgctgctggcgctgggctat
ccgctggccgatctgctgaagaccgcagcgcgtttacagccggtgtgcggccgtatggaa
gtgttcagcgcgccgggtaaacctgccgtggtggtggattatgcccatacgcctgacgcg
ctggaaaaagcgctgcaggcggcacgcctgcactgcagcggcaagctgtggtgcgtcttc
ggctgcggcggcgaccgcgacaaaggtaaacgtccgttgatgggcgctatcgcggaagag
tttgccgacatcgtggtcgttactgacgataacccgcgcaccgaagagccgcgggcgatt
atcaacgatattctggccggcatgctcgatgcaggtcaggcgaaggtgatggaaggccgc
gcggaagcggtgaccaacgccgtgatgcaggcgaaagagaacgacgtggtgctggtggcg
ggtaaaggccatgaagattaccagatcgtcggcaaccgccgtctggattattccgaccgc
gtgaccgtcgcgcgtctgctgggagcggtagcatga

DBGET integrated database retrieval system