KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4319Help
Entry
A79E_4319         CDS       T02213                                 

Definition
DNA polymerase III psi subunit
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:kpp00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:kpp00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:kpp03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:kpp03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kpp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4586332..4586745)
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAISLPEHIRLVMVAETPPSLTEPLIGDILRA
LAVTPDQVLQLTPERVAMLPQDSRCNSWRLGTEASLPLAGAQVSTPAFDELQTSAPARRA
LWQQICAHEHDFYPQHG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcaattacagcagctgggcattacccagtggtcgctgcgc
cgaccgggggcgttgcagggcgaaatcgctatctcgcttcctgaacatattcgtctggtg
atggtggcggaaaccccgccgtcgctgacagagccgctgattggcgacatattacgcgcg
ctggccgtgacgccagatcaggtcctgcagctgactccggagcgggtggcgatgctgccg
caggacagccgctgcaacagctggcggttgggcacagaggcgtcgctgccgctggcgggc
gcccaggtgtccacccccgcttttgatgaactccagaccagcgcgccggctcgcagggcg
ctctggcaacaaatctgcgcacatgaacacgatttctaccctcagcacggctga

DBGET integrated database retrieval system