KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4540Help
Entry
A79E_4540         CDS       T02213                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:kpp00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:kpp00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4822830..4823765
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSREDLELVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GGVPVLNAGDGANQHPTQTLLDLFTIQETQGRLENLNVAMVGDLKYGRTVHSLTQALAKF
NGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSAIDDVMAEVDILYMTRVQKERLDPSE
YANVKAQFVLRAADLEGARANMKVLHPLPRIDEITTDVDKTPHAWYFQQAGNGIFARQAL
LALVLNSELAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaacccgctatatcaaaaacatatcatttccataaacgatctcagccgcgaagac
ctcgaactggtgctggcgacggcggcaaagctgaaagccaatccacaacccgagctgctg
aagcataaggttatcgccagctgtttctttgaagcctcgacccgcacccgcctctctttt
gaaacctcgatgcaccgcctgggcgccagcgtggtcggcttttccgacagcgccaacacc
tcactgggcaaaaaaggggaaacgctggcggataccatctccgtcatcagcacctacgtc
gacgccatcgtgatgcgtcatccgcaggagggcgccgcgcgcctggcgaccgaattctcc
ggcggcgtgccggtactgaacgccggcgacggcgctaaccagcacccgacccaaaccctg
ctcgacctgttcaccattcaggagacccagggccgcctcgaaaacctcaacgtggcgatg
gtcggcgatctgaagtatggccgtaccgtccactccctgacccaggcgctggccaaattc
aacggcaaccgcttctacttcatcgccccggacgcgctggccatgccgcagtacatcctc
gatatgctcgatgaaaaaggcatcgcctggagcctgcatagcgccatcgacgacgtgatg
gcggaagtggatattctgtacatgacccgcgtgcagaaagagcgtctggatccgtcagaa
tacgccaacgtcaaagcgcagttcgtcctgcgcgccgccgacctcgaaggggcgcgcgcc
aacatgaaggtgctgcacccgctgccgcgcattgacgaaatcaccaccgatgtcgataaa
acaccgcacgcctggtacttccagcaggccggtaacggcatcttcgcccgccaggcgtta
ctggcattggtactgaatagcgagctggcactgtaa

DBGET integrated database retrieval system