KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4710Help
Entry
A79E_4710         CDS       T02213                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:kpp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kpp00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:kpp00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:kpp00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:kpp00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4998296..5000254
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPANIAERCLINPDQYKAQYQQSITDPDTFWGEQGKILDWMRPYTRVKNTSF
APGNISIKWYEDGTLNLAANCLDRHLAERGDQTAIIWEGDDASQSKHITYRELHADVCRF
ANVLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGLRAGRAIPLKKNVDDALKNPNVKSIEHVVVLKRTGGNIDWQEGRDLWWSDL
IANASAEHRPVEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHKVSILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVMDTWWQTETGG
FMITPLPGAIELKAGSATRPFFGVQPVLVDNEGLPLDGATEGNLAIADSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPTPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAITMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaattcacaaacaccctattcccgctaatattgcggaacgttgcctgattaac
ccggatcagtacaaggcgcagtaccaacaatccataaccgaccctgatacattttggggc
gagcagggcaagatccttgactggatgcggccctatacccgtgtaaagaacacctccttc
gcaccgggtaatatttccatcaaatggtatgaagatggcaccctgaacctcgccgctaac
tgtctcgaccgccacctcgccgaacgcggcgatcaaaccgccatcatctgggaaggcgac
gacgccagccaaagcaagcacatcacctaccgtgaactgcatgcagacgtgtgccgtttc
gccaatgtgttgctcgacctcgggattaaaaaaggcgacgtggttgctatctatatgccg
atggtgccggaagccgcggtggcgatgctggcctgcgcccgcatcggggcaatccactcg
gtcattttcggcggcttctcgccggaggcggtggccggacgcattatcgactccagctca
cgcctggtgatcaccgctgacgaagggctgcgcgccggtcgcgccatcccgctgaagaaa
aacgtcgatgacgcgctgaaaaacccgaacgtgaaaagcattgagcacgtggtggtcctg
aaacgcaccggcggcaatatcgactggcaggaaggccgcgatctgtggtggagcgacctg
attgcgaacgccagcgccgaacaccggcccgtcgaaatgaacgccgaagatccgctgttc
atcctctatacctccggctccaccggtaaaccgaaaggggtgctgcacaccaccggcggc
tatctggtctatgcggccaccacctttaaatacgttttcgactaccatccgggcgatatt
tattggtgcaccgccgacgtgggctgggtcaccggccatagctatctgctgtacggccca
ctggcctgcggcgccaccaccctgatgttcgaaggggtgccgaactggcctacgccggcg
cgcatgtgccaggtcgtcgataagcataaggtcagcattctctataccgccccgacggct
attcgcgccctgatggcggaaggcgacaaagctatcgaaggcacagaccgctcctcgctg
cgcattcttggctcggtcggcgaaccgattaacccggaagcctgggagtggtactggaag
aagatcggtaacgagaagtgcccggtgatggacacctggtggcagaccgaaaccggcggc
tttatgatcactccgctgccgggcgcgattgagctgaaggccggctccgcgacgcgtccg
ttcttcggcgtccagccggtgctggtggataacgaaggcctgccgctggatggcgccacc
gagggcaacctcgccatcgccgactcctggcccggccaggcgcgtaccctgttcggcgac
catgagcgctttgagcaaacctacttctccaccttcaaaaatatgtactttagcggcgac
ggcgcgcgtcgtgatgaagatggctattactggatcaccggccgggtcgatgacgtcctg
aacgtctccggacaccgtctggggaccgccgagatcgaatcggcgctggtctcgcaccca
aaaatcgccgaagcggcggtggtggggatcccgcataacatcaaaggtcaggccatctat
gcctacgtgacgctcaatcacggcgaagaaccgacgccggagttgtatgccgaagtgcgt
aactgggtacgcaaagagatcggtccgctggcgacgccggatgtgctgcactggaccgat
tcgctgccgaaaacccgctcgggcaaaatcatgcgccgcattctgcgtaagattgccgca
ggcgacaccagcaacctcggcgatacctcgaccctcgccgatcctggcgtcgtggaaaaa
ctgctcgaagagaagcaggccattaccatgccatcgtaa

DBGET integrated database retrieval system