KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4789Help
Entry
A79E_4789         CDS       T02213                                 

Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00630  Glyoxylate and dicarboxylate metabolism
kpp01100  Metabolic pathways
kpp01110  Biosynthesis of secondary metabolites
kpp01120  Microbial metabolism in diverse environments
kpp01200  Carbon metabolism
Module
kpp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A79E_4789
Enzymes [BR:kpp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     A79E_4789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFQ67985
Position
complement(5084762..5086081)
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELNKEWTNPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKLWR
LLHGEAKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPAN
SVPAVVDRINNTFRRADQIQWSAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDA
DAADLITSDCDPYDREFITGDRTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSKPDL
EQARRFAEAIHARFPGKLLAYNCSPSFNWKKNLDDKTIASFQQQLSDMGYKYQFITLAGI
HSMWFNMFDLAHAYAQGEGMRHYVEKVQQPEFAAGPEGYTFVSHQQEVGTGYFDKVTTII
QGGTSSVTALTGSTEEDQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacccaacaaatcgaagaattaaacaaagaatgg
acgaacccgcgctgggaaggcattacccgtccctacagcgcggaagaagtggtgaagtta
cgcggctcggtgaatccggaatgcacgctggcgcagcttggcgcggcgaaactgtggcgt
ctgctgcacggggaggcgaaaaaagggtacgtcaacagtctcggcgcgctgaccggcggc
caggccttgcagcaggcgaaggcgggtatcgaagccatttatctctccggctggcaggtg
gcggcggatgctaacctggcgtccagcatgtatccggatcaatcgctgtatccggccaac
tcggtaccggcggtggtggatcggatcaacaacaccttccgccgcgccgatcagatccag
tggtcagcgggaattgaaccgaacgatccgcgctttatcgactacttcctgccgatcgtg
gcggatgcggaggccggttttggcggcgtcctgaacgcctttgagctgatgaaatcgatg
attgaagccggtgcagcggctgttcacttcgaagatcagctggcatcggtgaagaagtgc
ggccatatgggcggtaaagtgctggttccgactcaggaggcgattcagaagctggtggcg
gcgcgtctggcggccgacgtgatgggggtcccgacgctggtcatcgcccgcaccgatgcc
gacgccgcggatttaattacctcagactgcgatccgtacgatcgtgagtttattaccggg
gatcgcaccagcgaagggttcttccgcacccacgccgggatcgagcaggcgatcagccgc
gggctggcctacgcgccgtatgcggatctggtgtggtgtgaaacgtcgaaaccggatctc
gagcaggcgcgccgctttgccgaggctatccatgcgcgtttcccgggcaaactgctggcc
tataactgctcgccgtcgtttaactggaagaaaaatctcgatgataaaaccatcgccagc
ttccagcagcagctgtcggacatgggatacaaataccagtttattaccctcgcggggatc
cacagcatgtggttcaacatgttcgacctcgcccatgcctacgctcagggtgaggggatg
cgccactatgttgagaaagtgcagcagccggaattcgccgccgggccggaaggctacacc
ttcgtctcgcatcagcaggaggtgggcaccggctacttcgacaaggtcaccaccattatc
cagggtggcacctcgtcggtaacggcgctgaccggctcgaccgaagaagatcagttttaa

DBGET integrated database retrieval system