KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4790Help
Entry
A79E_4790         CDS       T02213                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A79E_4790
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A79E_4790
   00630 Glyoxylate and dicarboxylate metabolism
    A79E_4790
Enzymes [BR:kpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A79E_4790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(5086146..5087747)
Genome map
AA seq 533 aa AA seqDB search
MTQQATITDELAFSQPYGEQEKQILTPEAVEFLTELVSRFTPARNKLLAARLQQQQAIDD
GQLPDFISETASIRNGDWTIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLQPNPAVLVCRVRGLHLPEKHVTWR
NEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQAWQEAAWWNDVFSFTEDRFDLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDTERNRQVLSKVTADKELEANNG
HDGTWIAHPGLADTAMAVFDRVLGDKPNQLSVTRSEDAPITAEQLLAPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLNDGTPVTKALFR
QWLAEELMVIQEELGEHRFSHGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaggcgacaatcaccgatgaactggcctttagtcagccctatggcgagcag
gagaagcagatcttaacgcctgaggcggtagaatttctgacggaactggtgagccgcttt
acgccggcgcgcaataagctgctggccgcgcgtttgcagcaacagcaggctattgacgac
gggcagcttccggattttatttcggaaactgcttccattagaaatggcgactggactatt
cgcggtatcccggctgatttgcaggatcgccgtgttgaaatcaccggccccgtcgagcgc
aagatggtcattaacgcgctgaatgccaacgtcaaagtctttatggcggactttgaggat
tcgctggcgcctgactggcgcaaagtcattgatggtcaaatcaacctgcgcgatgccgtg
aacgggaccatcagctacaccaacgaggccggcaaaatctatcagttgcagcccaatccc
gctgtgctggtatgccgtgtgcgcggcctgcatctgccggaaaagcatgtgacctggcgt
aatgaggccatccccggcagcctgttcgattttgcgctctatttctttcataactaccag
gcgctgctggcgaaaggaagtggtccctacttctatctgccaaaaacacaggcctggcag
gaggcggcatggtggaacgatgtcttcagttttacggaagatcgctttgacctgccgcgg
ggcaccatcaaagccacgctgctgattgagacgctgccagcggtgttccagatggatgag
atcctgcatgcgctgcgcgaccatattgttggcctgaactgcggccgctgggattacatc
ttcagctacatcaagacgctgaaaaaccatccggatcgcgtactgccggaccggcaggtg
gtgacgatggataaacccttcctcagcgcctactcacggttgttgattaagacctgccat
aaacgcggcgcgtttgcgatgggcggtatggcggcgtttatcccgagcaaagataccgaa
cgtaaccgccaggtgctgagtaaagtcaccgccgataaagagctggaggccaacaacggt
cacgatgggacctggatcgcccacccgggcctggcggataccgccatggcggtgtttgac
cgcgtgctgggcgataagccgaatcagctctcggtcacccggagcgaggatgcgccaatt
accgctgaacaactgctggctccctgcgagggcgaacgcacggaagccggaatgcgcgcc
aacattcgcgtggcggtgcagtacatcgaagcgtggatctccggcaacggctgcgtaccg
atttatggcctgatggaagacgccgcaacggccgagatctcgcgcacctctatctggcag
tggatccatcatcagaaaaccctgaacgacggtaccccagtcactaaggcgctgttccgc
cagtggctggcggaagagctgatggtgattcaggaggagctgggagagcaccgcttcagc
cacggccgctttgacgatgcggcgcgactgatggagcagatcaccacctccgacgagcta
attgattttctgacattgccgggctaccgcctgctggcctaa

DBGET integrated database retrieval system