KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4866Help
Entry
A79E_4866         CDS       T02213                                 

Definition
Lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    A79E_4866
Enzymes [BR:kpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     A79E_4866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5165109..5166167)
Genome map
AA seq 352 aa AA seqDB search
MCQHCVIHGKKRFSAVNRGVNPMFGQKKDWETRENAFAAFSMGPLTDFWRQREEAEFKGV
DDVPVRFVRFCAQHNDRLVLICPGRIESYVKYAEVAYDLFHCGFDVMIIDHRGQGRSGRL
LSDTHRGHVVNFSDYVDDLAALWQQQVVPGHWRKRFILAHSMGGAIATLFLQRYRAHCDA
IALCAPMFGIIIRLPDWMVRHILDWAEGHQRIREEYAIGTGRWRALPFAVNVLTHSRQRY
RRNLRFYADEPRLQVGGPTWHWVREGMLAGDEVLANVEKDTAPTLLLQAEEERVVDNLMH
DRYCELRAAAGHPCEGGKPLVIEGAYHEILFEKDAMRSVALNAIVEFFNRHT
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtcagcattgtgtgatacacggtaaaaaacgattttcagcggttaacaggggtgta
aacccgatgtttgggcagaaaaaggactgggaaacacgagaaaacgcgtttgcggccttt
agcatggggccgctgacggatttctggcgacagcgcgaagaagctgaatttaaaggcgtc
gacgatgtaccggtacgctttgtccgcttttgcgcgcaacataacgatcgtctggtgttg
atttgccccgggcgcattgaaagctacgtgaagtatgctgaagtggcctacgatctcttt
cactgcggctttgacgtgatgatcattgaccatcgcgggcagggacgctcgggccgcctg
ctctcagatacccaccgcggacacgtggttaacttcagcgactatgttgatgacctggcc
gcgctctggcagcagcaggtggttcctggacactggcgaaaacggtttatccttgctcat
tctatgggcggagcgattgccacgctttttctgcaacgttaccgggcgcattgcgatgca
atagcgctctgcgcgccgatgttcgggattatcattcggctgccggactggatggtgcgc
catattctcgactgggctgagggccatcagcgcattcgcgaagagtatgccatcggcacc
gggcgctggcgggcgctgccttttgccgttaacgtgctgacgcacagtcggcaacgctat
cgtcgcaacctgcgcttctatgccgatgagccgcggctgcaggtcggcggtccgacctgg
cactgggtgcgtgagggcatgctggccggcgacgaagtgctggcgaatgtggaaaaagat
accgccccgacgctgcttttacaggcggaagaggagcgggtggtcgataatctgatgcac
gaccgctattgcgaattacgggccgctgccggccatccctgtgagggcggtaagccgctc
gtcattgaaggggcatatcatgagatcctttttgaaaaggacgctatgcgctcagtcgcg
ctcaatgccatcgtcgagtttttcaatcgacatacttaa

DBGET integrated database retrieval system