KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4884Help
Entry
A79E_4884         CDS       T02213                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00860  Porphyrin and chlorophyll metabolism
kpp01100  Metabolic pathways
kpp01110  Biosynthesis of secondary metabolites
kpp01120  Microbial metabolism in diverse environments
Module
kpp_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A79E_4884
Enzymes [BR:kpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     A79E_4884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFQ68066
Position
5184261..5185001
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPLPQGEALVSRLRAMGRVAWSFPLIEFTPGRELPALGDALARLGPDDLLFALS
QHAVEFAHARLQQQGLLWPTSPRYFAIGRTTALALHTVSGQHIHYPLDREISEVLLQLPE
LQNIAGKNALILRGNGGRELLGATLTERGARVTFCECYQRSAKHYDGAEEAMRWQSRGVT
TLVVTSGEMLQQLWSLIPQWYREQWLLHCRVVVVSERLALQARELGWQEIQVADSADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctggtcactcgtccactaccgcaaggagaagcgctggtcagccgtctgcgg
gccatgggacgcgtggcctggagctttccgctgatagaatttacgcccggcagggagctt
cccgcgctgggcgatgcgcttgcccgactgggacccgacgatctgctatttgcgctatcc
cagcatgcggtggaattcgcccatgcccgtctgcagcagcagggcctgctctggcccact
tctccgcgctattttgccattggccgcacgacggcgctggccctgcatacggtcagtggg
cagcatatccattacccgttagatcgggaaattagcgaagtcttgctacaattacctgaa
ttacaaaacattgccgggaaaaatgcgctgatcctacgcggcaatggcgggcgggaactc
ttaggcgcgacgctgaccgagcgcggcgccagggtcacattttgtgaatgttatcaacgt
agtgcaaaacattacgatggcgcagaagaagcgatgcgctggcaatctcgcggagtcacc
acgctggtggtcaccagcggcgagatgctgcagcagctatggtcgttaataccgcaatgg
tatcgcgaacagtggctcctgcactgccgcgttgtcgttgtcagcgaacgtctggccctt
caggcccgggaactgggctggcaggagattcaggttgccgatagcgccgacaacgatgcg
ctgctacgcgcattacaataa

DBGET integrated database retrieval system