KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4995Help
Entry
A79E_4995         CDS       T02213                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A79E_4995
   01230 Biosynthesis of amino acids
    A79E_4995
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A79E_4995
   00030 Pentose phosphate pathway
    A79E_4995
   00051 Fructose and mannose metabolism
    A79E_4995
   00052 Galactose metabolism
    A79E_4995
  Energy metabolism
   00680 Methane metabolism
    A79E_4995
Enzymes [BR:kpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A79E_4995
Protein phosphatases and associated proteins [BR:kpp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     A79E_4995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5300230..5301210)
Genome map
AA seq 326 aa AA seqDB search
MKIGIVISGGDVSGMNNFIFQIARQANADITLFNGGIPGLLEKSHQDMAWRDLVDYSITA
VPIITSGRTSRKLQRSEYESIAKKLKSLRIDVLIMAGGDGSLQFLNTLSEFEINCFGVGM
TIDNDVYGSDYTIGFSTACEQIIKEVSRLRNTGRALPGRVFMVEILGGYCGELTLQSAIK
CNADIALIPEAQMPLAVLAERITRKLSTQNSVVILCSEGYTKEYSPGFQGAIDTMIKQLE
PQIGVRIRKTIVGYGLRSGDPTCEEIYQGTIMASEVVRCIQSGMKNKAIIINSSNKPIPI
DLVSMKKRLVDTEGHHYKLAKQLNII
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggtatcgttattagcggcggggatgtttctggaatgaataattttatattc
cagatagccaggcaggctaatgctgatatcacgctgtttaatggcggtattccagggcta
ctggagaaaagtcatcaggatatggcgtggcgcgatctggttgattattcaattaccgcg
gtgccgatcattacctcggggcgaaccagtcgcaaactgcagcgcagtgaatatgaaagc
attgctaaaaaacttaaatctctgcgtattgatgtgctcattatggccgggggggatggc
agcctgcagtttctgaatacccttagtgaatttgagattaattgctttggtgtgggaatg
actatcgataatgatgtgtatggcagtgattatacgattggtttttccacggcctgtgag
caaattattaaagaagtctctcgtttaagaaataccggaagagcgctgcccggtcgggtt
tttatggttgagatattaggaggctattgtggagaactaacgttgcagtccgccattaaa
tgtaatgcggatattgccctgatcccggaggcacagatgccgttggccgtgctcgcggaa
cggattacccggaagctgagtacgcagaatagcgtcgttatcctctgctcagaaggctat
accaaagagtactctcccggctttcagggggcgattgataccatgattaaacagctggaa
ccacaaataggtgtccgtatccgtaaaacgatcgtcggctatggtttacgcagcggtgat
ccaacctgcgaagagatttatcagggcactattatggccagtgaagtggttcgctgtatt
cagtcaggtatgaaaaataaagccataataattaattccagtaacaaacctattccgatt
gatttagtcagtatgaaaaaacgtctggtcgatactgaaggacatcattataaacttgcc
aagcaactcaatattatttga

DBGET integrated database retrieval system