KEGG   Klebsiella pneumoniae: KPR_0119Help
Entry
KPR_0119          CDS       T02793                                 

Gene name
rbsK
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
kpr  Klebsiella pneumoniae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KPR_0119 (rbsK)
Enzymes [BR:kpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KPR_0119 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
119227..120159
Genome map
AA seq 310 aa AA seqDB search
MMKTAGKLVVLGSINADHILNLDAFPTPGETVTGHHYQVAFGGKGANQAVAAGRSGADIA
FIACTGDDDIGERIRRQLASDKIDVAPVRAVAGEATGVALIFVNAEGENVIGIHAGANAA
LSVSQVEAEKERIASAQALLMQLESPLESVIAAAKIAHHHHTTVVLNPAPARELPDELLA
LVDIITPNETEAEKLTGIRVESDEDAAKAADVLHAKGIGTVMITLGSRGVWLSAEGESRR
IPGFRVQAIDTIAAGDTFNGALVTALLEGTALPEAIRFAHAAAAIAVTRKGAQPSVPWRT
EIDEFLAQQG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaactgcaggcaaacttgtcgtccttggcagtatcaatgccgatcacattctt
aaccttgacgctttcccgacgccgggcgaaaccgtcaccggccaccattatcaggtggcg
ttcggtggaaaaggggccaaccaggcggtggccgccgggcgcagcggagcggatatcgcg
tttatcgcctgcaccggcgatgacgatatcggtgaacgcatccgtcgtcagctggcgagc
gataaaatcgacgtggcgcccgtgcgtgcggttgccggggaagcgaccggggtggcatta
attttcgttaacgccgaaggtgagaatgtcatcggtattcatgccggcgccaatgcggcg
ctttccgtctcccaggttgaggcggaaaaagagcgtatcgccagcgcacaggcgttgttg
atgcagctggagtcgccgctggagagcgtcatagcggcggcgaaaatcgcccatcaccat
cacaccaccgtggtgctgaaccccgcgccagcgcgtgaactaccggatgaactgctggcg
ctggtggatattattacccctaacgaaaccgaagcggaaaagctgaccggtattcgcgtt
gagagtgacgaagatgcggcaaaagccgccgacgtgctgcatgccaaaggcattggtacg
gtgatgatcaccctcggcagccgcggcgtctggctcagtgccgaaggcgaaagccgccgg
atcccagggtttcgcgtacaggccattgatactatcgcggccggtgatacctttaacggc
gcgctggtgaccgcgctgctggaagggaccgccctgccggaggcgattcgctttgcgcat
gccgcagcggcgatcgccgtaacccgcaaaggcgctcagccgtccgtgccttggcgcaca
gagatcgatgaatttttagcgcaacaggggtaa

DBGET integrated database retrieval system