KEGG   Klebsiella pneumoniae: KPR_0681Help
Entry
KPR_0681          CDS       T02793                                 

Gene name
malQ
Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
kpr  Klebsiella pneumoniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPR_0681 (malQ)
Enzymes [BR:kpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     KPR_0681 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
732768..734861
Genome map
AA seq 697 aa AA seqDB search
MESKRLDNAALAAGISPSYINAHGKPQSIAAVTKQRLLDAMHRSTAATKVAVNPLPNVKI
FTHGKKMSLPVAGRGEYQWILTTEDGKQYQGKTRGGETLPLPAKLPEGYHSLTLTQEGER
WHCRTIVAPARCYEPQPLKEGKKLWGTCVQLYTLRSEKNWGIGDFGDLRAMLPEIARRGG
SFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFQRSEEAQAWWQSPATQQ
ALQAARETDDVDYTAVTTLKMTALRMAWKQFSRREDEQMTAFREFVLREGESLYWQAAFD
ALHAWQVQQDPLRWGWPAWPKAFQDIDSPEVKAFCVEHEDDVSFYLWLQWLAWSQFAACW
ETSQRDGMPIGLYRDLAVGVAEGGSETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHIIAARAYEPFIDLLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLL
SLLALESQRHRCMVIGEDLGTVPVEIVSKLRNSGVYSYKVLYFESDAEKTFRAPALYPEQ
SMAVATTHDLPTLRGYWESGDLTLGKALGLYPDEVVLRGLYQDRELAKQGLLDALHKYGC
LPKRAGHKASLMSMTGILNRGMQRYIADSNSALLGLQPEDWLEMATPVNIPGTSTEYPNW
RRKLSVTLEQMFADERVNKLIKDLDKRRKAASKKAAS
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggagagtaaacgcctcgataatgccgcgctggcggcgggcatcagccccagctatatc
aacgcgcacggcaagccgcagtctatcgcggctgtcaccaaacagcgcctgctggatgcg
atgcatcgctctaccgccgccacgaaagtggcggttaacccgctgccgaacgtgaaaatt
ttcactcacggcaaaaaaatgtcgctgccggtggcaggacgcggtgagtatcagtggatc
ctgactactgaggacggtaagcagtatcaagggaaaacccgcggcggcgagacgctgccg
ctgccggccaaactgccggaggggtaccactccctgaccctcacccaggagggggagcgc
tggcactgccggactatcgtcgcgccagcccgctgctatgagccgcagccgctgaaagag
gggaaaaagctgtggggcacctgcgtgcagctgtataccctgcgctcagagaaaaactgg
gggatcggcgattttggcgatctgcgggccatgctgccggaaatcgcccgccgcggcggg
tcgtttattggccttaacccgattcatgctctctatccggcgaacccggagagcgccagc
ccctatagcccgtcttcacgtcgctggctgaacgttatttatatcgacgtcaacgcggtt
gaagatttccagcgtagcgaagaggcgcaggcgtggtggcagtctccggcaacgcagcag
gcactgcaggcggcgcgggaaacggacgatgtggattataccgccgtcactacgctgaaa
atgaccgcgctgcgtatggcgtggaaacaattctctcgtcgtgaagatgagcagatgaca
gcgttccgcgagtttgttctgcgcgaaggggaaagcctctactggcaggcggctttcgat
gcgctgcacgcctggcaggtacaacaggacccgctgcgctggggctggccggcctggccg
aaggcctttcaggatatcgacagcccggaggtgaaagccttctgcgtcgagcatgaggat
gacgtcagtttctatctctggctgcagtggctggcctggagtcagtttgccgcctgctgg
gaaaccagccagcgtgacggcatgccgatcggcctctaccgcgatctggcggtgggcgtc
gccgagggcgggtcggaaacctggtgcgatcgtgaactgtactgcctgaaagcatccgta
ggcgcgccgccggatattctgggcccgctgggccagaactggggcctgccgccgatggat
ccgcatatcattgccgcccgcgcctatgagccgtttatcgacctgctgcgcgctaatatg
cagaactgcggcgcgttgcgcatcgatcacgtgatgtctgtgctgcgtctgtggtggatc
ccgtatggtgaaaccgccgaccatggcgcttacgttcagtatccggtcgacgatctgctg
tcgcttctggcgctggaaagccagcgtcatcgctgcatggtgatcggtgaagatctgggc
acggtaccggtggagatcgtcagcaagttacgcaacagcggcgtctattcctataaggtg
ctctattttgagagtgatgcagagaaaacgttccgcgcgccggcgctgtacccggagcaa
tcaatggctgtggcgacgacgcacgacctgcccactctccgcggctactgggaaagcggc
gatctgacgttaggtaaagcgctgggcctctatcctgatgaggtggtgctgcgcggactg
taccaggaccgcgagctggcgaaacaagggctgctggacgcgctgcataagtacggctgt
ctgcccaagcgcgccggccataaggcctctctgatgagcatgacggggatcctcaaccgg
gggatgcagcgttatattgccgacagcaacagcgccctgctgggcctgcagccggaagac
tggctggagatggcgacgccggttaacattccgggcaccagcaccgagtacccgaactgg
cgccggaagctgtccgtcaccctggagcagatgtttgccgatgaacgggtcaataagctg
attaaggatctggataaacggcgcaaggcggcgagcaagaaagccgcctcctga

DBGET integrated database retrieval system