KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_0786Help
Entry
KPR_0786          CDS       T02793                                 

Gene name
xylA
Definition
hypothetical protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:kpr00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kpr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
820967..822286
Genome map
AA seq 439 aa AA seqDB search
MQTYFDQVDRVRFAGPKTDNPLAFRHYNPDEIVLGKRMADHLRFAACYWHNFCWNGADMF
GAGSFERPWQAAGDALEMAKRKADVAFEFFYKLNVPYYCFHDVDVSPEGASLKDYLHNFA
IMTEVLAEKQQQTGVKLLWGTANCFTHPRYGAGAATNPDPEVFAWAATQVVTAMNATHQL
GGENYVLWGGREGYESLLNTDLRQEREQIGRFLQMVVEHKHKIGFGGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLENEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVDANRG
DAQLGWNTDQFPNSVEENTLVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDMFYGHIGAM
DVMALSLKLAARMIEDGKLDQGLAKRYAGWQGELGQKIMTGQMSLDNIARYAEQHNLNPQ
PQSGRQELLENLVNTYIFG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacctatttcgaccaggttgatcgcgttcgttttgccggacccaaaaccgataat
ccgctggcgtttcgccactataatccggatgaaatcgtgctgggaaaacgcatggccgat
catctgcgttttgccgcctgttactggcataacttctgctggaatggcgcggatatgttt
ggcgccggctcgtttgagcgtccctggcaggccgcgggcgatgcgctggaaatggccaaa
cgcaaagcggacgtggcgtttgaatttttctacaagctcaacgtgccgtattactgcttc
cacgatgtcgacgtctcgccagaaggcgcatcgctgaaagattatttgcataatttcgcc
atcatgaccgaggtgctggcagagaaacagcagcaaaccggcgtgaaactgctgtggggc
accgccaactgctttacccacccgcgctacggcgccggagcggcgaccaaccccgatccg
gaggtgtttgcctgggcggccacgcaggtggtgaccgccatgaacgctacccaccagctc
ggcggcgaaaactatgttctgtggggcggccgcgaaggttacgagtccctgctgaatacc
gacctgcgccaggagcgtgagcagattggccgcttcctgcagatggtggtggagcacaag
cataagattggctttggcggcacgctacttatcgagccgaaaccgcaggagcccaccaag
catcagtacgattacgatgtcgcgacggtgtatggtttcctgaagcagtttggtctggaa
aatgagatcaaggtgaacattgaagctaaccacgccaccctggcggggcactctttccat
catgaaatcgccagcgccatcgcgctgggcattttcggctccgttgatgccaaccgcggc
gatgcgcagctcggctggaataccgatcagttcccgaacagcgtggaagagaataccctg
gtgatgtacgagatcctcaaagccgggggattcaccaccggcggcttgaactttgacgcc
aaagttcgccggcagagcaccgacaaatacgacatgttctatggccatattggcgccatg
gacgtgatggcgctgtccctcaagctggccgcgcgcatgattgaggatggcaagctcgat
cagggtctggcaaaacgctatgccggctggcagggcgagctggggcagaaaattatgacc
gggcagatgtcgctggataatattgcccgatacgctgagcagcataatctgaatccgcag
cctcagagcgggcgtcaggaattactcgaaaatctcgtcaatacctatatctttggttaa

DBGET integrated database retrieval system