KEGG   Klebsiella pneumoniae: KPR_0786Help
Entry
KPR_0786          CDS       T02793                                 

Gene name
xylA
Definition
hypothetical protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
kpr  Klebsiella pneumoniae
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPR_0786 (xylA)
   00051 Fructose and mannose metabolism
    KPR_0786 (xylA)
Enzymes [BR:kpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     KPR_0786 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
820967..822286
Genome map
AA seq 439 aa AA seqDB search
MQTYFDQVDRVRFAGPKTDNPLAFRHYNPDEIVLGKRMADHLRFAACYWHNFCWNGADMF
GAGSFERPWQAAGDALEMAKRKADVAFEFFYKLNVPYYCFHDVDVSPEGASLKDYLHNFA
IMTEVLAEKQQQTGVKLLWGTANCFTHPRYGAGAATNPDPEVFAWAATQVVTAMNATHQL
GGENYVLWGGREGYESLLNTDLRQEREQIGRFLQMVVEHKHKIGFGGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLENEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVDANRG
DAQLGWNTDQFPNSVEENTLVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDMFYGHIGAM
DVMALSLKLAARMIEDGKLDQGLAKRYAGWQGELGQKIMTGQMSLDNIARYAEQHNLNPQ
PQSGRQELLENLVNTYIFG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacctatttcgaccaggttgatcgcgttcgttttgccggacccaaaaccgataat
ccgctggcgtttcgccactataatccggatgaaatcgtgctgggaaaacgcatggccgat
catctgcgttttgccgcctgttactggcataacttctgctggaatggcgcggatatgttt
ggcgccggctcgtttgagcgtccctggcaggccgcgggcgatgcgctggaaatggccaaa
cgcaaagcggacgtggcgtttgaatttttctacaagctcaacgtgccgtattactgcttc
cacgatgtcgacgtctcgccagaaggcgcatcgctgaaagattatttgcataatttcgcc
atcatgaccgaggtgctggcagagaaacagcagcaaaccggcgtgaaactgctgtggggc
accgccaactgctttacccacccgcgctacggcgccggagcggcgaccaaccccgatccg
gaggtgtttgcctgggcggccacgcaggtggtgaccgccatgaacgctacccaccagctc
ggcggcgaaaactatgttctgtggggcggccgcgaaggttacgagtccctgctgaatacc
gacctgcgccaggagcgtgagcagattggccgcttcctgcagatggtggtggagcacaag
cataagattggctttggcggcacgctacttatcgagccgaaaccgcaggagcccaccaag
catcagtacgattacgatgtcgcgacggtgtatggtttcctgaagcagtttggtctggaa
aatgagatcaaggtgaacattgaagctaaccacgccaccctggcggggcactctttccat
catgaaatcgccagcgccatcgcgctgggcattttcggctccgttgatgccaaccgcggc
gatgcgcagctcggctggaataccgatcagttcccgaacagcgtggaagagaataccctg
gtgatgtacgagatcctcaaagccgggggattcaccaccggcggcttgaactttgacgcc
aaagttcgccggcagagcaccgacaaatacgacatgttctatggccatattggcgccatg
gacgtgatggcgctgtccctcaagctggccgcgcgcatgattgaggatggcaagctcgat
cagggtctggcaaaacgctatgccggctggcagggcgagctggggcagaaaattatgacc
gggcagatgtcgctggataatattgcccgatacgctgagcagcataatctgaatccgcag
cctcagagcgggcgtcaggaattactcgaaaatctcgtcaatacctatatctttggttaa

DBGET integrated database retrieval system