KEGG   Klebsiella pneumoniae: KPR_0916Help
Entry
KPR_0916          CDS       T02793                                 

Gene name
deoA
Definition
hypothetical protein
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
kpr  Klebsiella pneumoniae
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KPR_0916 (deoA)
Enzymes [BR:kpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     KPR_0916 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
949253..950575
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAADDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYANYLPTAMLSKAVYADTEGFISAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTEMARLGDRVDGQRPLAVIHAKDENSWQEAAKAVKAA
IKLDDKAPEITPTVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcaggcattaagcgatgaa
gagatccgctttttcatcaacggcatccgcgacaatactatctctgaagggcagatcgcc
gcgctggcgatgaccatcttcttccacgatatgtctatgccggagcgcgtttcgctgacc
atggcgatgcgggattccggtaccgttctggactggaaaagcctcaaccttaacggtccg
atcgtcgataaacactctaccggcggcgtcggggatgtcacttcgctgatgctggggccg
atggtggccgcctgcggtggttacgtaccgatgatctccggccgcggcctcggccatacc
ggcggtacgctggacaaactggaagcgatcccgggcttcgatatcttcccggacgacaac
cgcttccgcgagattataaaagatgttggcgtggcaattatcgggcagaccagctccctt
gccccggccgacaaacgtttctatgccacccgcgatattaccgcgacggtggactccatc
ccgctgattaccgcctcgattctggcgaagaagctggcggaagggctggatgcgctggtg
atggacgtcaaagtcggcagcggcgcctttatgccgacttatgaactctctgccgcgctg
gccgaagcgatcgtgggtgtcgccaacggtgccggcgtgcgcaccaccgcgctgctgacc
gatatgaatcaggtactggcctccagcgccggcaacgccgttgaagttcgcgaagcggtg
cagttcctgaccggcgaataccgcaacccgcgcctgttcgacgtgacaatggcgctgtgt
gtggaaatgctgatctccggcaagctggcggcggacgatgccgaggcgcgcgcgaagctg
caggcggtgctggataacggtaaagcggcggaagtgtttggccgcatggtcgcggcgcag
aaagggccgagcgactttgtcgagaattatgctaattatctgccgacggcgatgctgagc
aaagcagtctatgctgataccgaaggttttatcagcgcgatggatactcgcgcgctgggc
atggcagtggtttctatgggcggcggccgccgtcaggcatcggacaccattgactatagc
gttggctttaccgagatggcgcgtctgggtgaccgcgtcgacggacagcgtccgctggcg
gtgatccatgccaaagacgagaacagctggcaggaggccgcgaaagcggtcaaagcggcc
attaaactggacgataaagccccggaaattacaccgacagtctatcgccgtatcactgaa
tag

DBGET integrated database retrieval system