KEGG   Klebsiella pneumoniae: KPR_1095Help
Entry
KPR_1095          CDS       T02793                                 

Gene name
mrcB
Definition
hypothetical protein
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
kpr  Klebsiella pneumoniae
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KPR_1095 (mrcB)
Enzymes [BR:kpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     KPR_1095 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     KPR_1095 (mrcB)
Glycosyltransferases [BR:kpr01003]
 Polysaccharide
  Bacterial polysaccharide
   KPR_1095 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1151545..1154112
Genome map
AA seq 855 aa AA seqDB search
MRRKSMAGDDREPIGRKGRPSRPTKQKVTRRRVREEDYDDEYDDDDYEDEKPVPRKAKGK
GGKPRRKRSWLWLLVKLGIVFAVLIAAYGVYLDQKIRSRIDGKVWELPAAVYGRMVNLEP
DMQISKNEMVRLLNATQYRQVSAMTRPGEYTVQANSIEMIRRPFDFPDSKEGQVRARLTF
DGDHLETIENMDNNRQFGFFRLDPRLITMLQSPNGEQRLFVKRSGFPDLLVDTLLATEDR
HFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMAL
IVDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVK
GASVYNPWRNPKLALERRNLVLRLLQQQQVIDQELYDMLSARPLGVQPRGGVISPQPAFM
QMVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAASEGIPVLKKQRKLADLETAMV
VVDRFTGEVRAMVGGAEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPNQYRLNTWIAD
APVTIRLSNGQTWSPQNDDRRFSGQVMLVDALTRSMNVPTVNLGMALGLPAVVDTWTKLG
APKNQLNAVPSMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGTVLYQSYPQ
AERAVPAQAAYMTLWTMQQVVQRGTGRQLGTKYPGLHLAGKTGTTNNNVDTWFAGIDGSQ
VTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLVLTVPEDVVDMGVDSNGNFVCS
GGMRSLLVWTTQPDALCRQGEMMQQQQLQQQEAKNPFNQSGQQQPPQQQQKQQPPKQQEK
SDGVAGWIKDMFGSN
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
ttgcggagaaaaagcatggcgggagatgaccgcgagcctatcggacgtaagggaagaccc
tcacgtccgactaaacagaaagtcacccgtcgccgggtccgggaagaggactacgacgac
gagtatgatgacgatgattatgaggatgagaaaccggtgccgagaaaagccaaaggcaaa
ggtggcaagcctcgtcggaagcgcagctggctgtggctgctggtcaagctggggattgtc
ttcgcggtgctgattgccgcctatggcgtctacctcgaccagaaaatccgcagccgcatt
gacggtaaagtctgggagctgccggccgcggtctatggccggatggtcaaccttgagccg
gacatgcagatcagcaaaaacgagatggtgcgtctgctcaacgccacgcagtatcgccag
gtcagcgcgatgacgcgccccggcgaatataccgtgcaggctaacagcatcgagatgatc
cgtcgtccgttcgatttcccggacagtaaggaagggcaggtgcgcgcgcgtcttaccttc
gacggcgaccatcttgagaccatcgagaatatggataataaccgccagttcggtttcttc
cgcctcgatccgcgccttatcaccatgctgcagtcgccgaacggcgagcagcgcctgttc
gtgaagcgcagcggcttccccgatctgctggtggataccctgctggcgaccgaagaccgc
cacttctatgagcacgatgggatcagtctctactccatcggccgcgcggtgctggcgaac
ctgacggcaggccgaacggtgcagggggcgagtaccctgacccaacagctggtgaaaaac
ctgttcctctccagcgaacgctcctactggcgtaaagccaacgaagcgtatatggcgctg
atcgtcgacgcccgctacagcaaggatcgcatccttgagctgtatatgaacgaggtgtac
ctcggccagagcggcgataacgaaattcgcggcttcccgctggccagcctgtattacttc
ggccgtccggtggaagagctgagcctcgaccagcaggcgctgctggtggggatggtgaaa
ggggcgtcggtctataacccgtggcgtaacccgaaactggcccttgaacgacgcaatctg
gtgctgcgtctgctgcagcagcagcaggttatcgaccaggagctgtacgacatgctcagc
gcccgtccgctgggcgtgcagccgcgcggcggggtgatttcaccgcagccggcgtttatg
cagatggttcgtcaggaactgcaggcgaagctgggcgataaagtgaaagatctttccggc
gtgaagatcttcaccactttcgactcggtggcgcaggatgcggcggaaaaagcggcctcc
gaagggatcccggttctgaagaaacagcgtaagctggcagacctggaaaccgccatggtg
gtggttgaccgcttcaccggcgaagtgcgggcgatggtcggcggcgcggagccgcagttc
gccggttataaccgcgcgatgcaggcccgccgatcgattggttctctggccaagccggcg
acctatctgaccgcgctgagccagccgaatcagtatcgcctgaatacctggatcgccgat
gcgccggtgacgattcgcctgtccaacggtcagacgtggtccccgcagaacgacgatcgt
cgtttcagcggtcaggtgatgctggtggatgccctgactcgctcgatgaacgtcccgacg
gttaacctcgggatggcgctgggcttgccggcggtagtcgatacctggactaaactgggg
gcgccgaagaatcagctcaacgcggtgccgtcgatgctgcttggcgcgctgaacctgacg
ccgattgaagtggcccaggccttccagaccatcgccagcggtgggaaccgtgcgccgctt
tccgcgctgcggtcagtgattgccgaagatggcactgtgctctaccagagctatccgcag
gcggagcgcgcggtgcctgcccaggcggcctacatgacgctgtggactatgcagcaggtg
gtgcagcgcggtacggggcgtcagctggggacgaagtatccgggcctgcatctggcgggg
aaaaccgggaccaccaacaataacgtcgatacctggttcgccggcatcgacggtagtcag
gtgaccatcacctgggtggggcgcgacaataaccagccgaccaaactgtacggcgccagc
ggcgcgatgtcgatttaccagcgctatctggcgaaccagacgccaacgccgctggtgctg
acggtgccggaagacgtggttgatatgggcgtggacagcaacggcaacttcgtctgcagc
ggcggtatgcgttcgctgctggtctggaccacgcagccggatgcgctgtgccgtcagggc
gaaatgatgcaacagcagcagttgcagcaacaggaagcgaaaaatccgtttaatcagtcc
gggcagcagcagccgccgcagcagcaacagaagcaacagccgccgaagcagcaggaaaag
agcgacggcgtcgcgggctggatcaaggatatgttcggcagtaactga

DBGET integrated database retrieval system