KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_1763Help
Entry
KPR_1763          CDS       T02793                                 

Gene name
yqeF
Definition
(GenBank) highly similar to probable acetyl-CoA acetyltransferase from Escherichia coli strain K12 (sp|Q46939)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPR_1763 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    KPR_1763 (yqeF)
   00640 Propanoate metabolism
    KPR_1763 (yqeF)
   00650 Butanoate metabolism
    KPR_1763 (yqeF)
  Lipid metabolism
   00071 Fatty acid degradation
    KPR_1763 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    KPR_1763 (yqeF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPR_1763 (yqeF)
   00310 Lysine degradation
    KPR_1763 (yqeF)
   00380 Tryptophan metabolism
    KPR_1763 (yqeF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPR_1763 (yqeF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPR_1763 (yqeF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KPR_1763 (yqeF)
Enzymes [BR:kpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPR_1763 (yqeF)
Exosome [BR:kpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPR_1763 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1853887..1855065
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTPIGCFQGALSRYSAVELGSVVVKALVEKTGIDPHSVDEVILGQVLTAG
TGQNPARQSAIRGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREFGISRELQDAWAL
SSQHKARKAIDSGRFRDEIVPVVTEHNGAARTVDTDEQPRVDASAEGLASLQPTFDRLGS
VTAGNASSINDGAAAVMMMSEAKALELGLPILARIRAFASVGVDPALMGIAPVHATRRCL
ERAGWRLDDVDLIEANEAFAAQAISVGRVLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMIKRDARKGLATLCIGGGQGVALAVERA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatgtcgtgatcgtcggcgcgctgcgaacgccgattggctgctttcagggcgca
ttatcgcgctattcagccgtcgagctggggagcgtggtggtgaaggcgctggtggagaag
acgggaatcgatccgcacagcgtggatgaagtgatcctcggccaggtgctgaccgcgggg
accggacaaaatccggcgcgtcagtccgctattcgcggtgggctgcctaacaccgtatcg
gctatcaccattaacgatgtctgcggttccggcctgaaggctctgcacctcgctacccag
gcgatccagtgcggggaagcggacgtggtgatcgctggcggccaggagaatatgagccgc
gctccgcatgtgcttaccgacagccgcaccggcgcccagctgggcaatagccagctgatt
gacagtctggtgcatgatgggctgtgggatgctttcaacgattatcatatgggcgtcacg
gcggaaaacctggcccgggaatttggcatcagtcgcgagctgcaggacgcctgggcgctc
agctcacagcataaggcgcgcaaggcgattgattccggtcgctttcgcgatgagatcgtc
ccggttgtcaccgagcataacggcgcggcgcgcaccgtggataccgatgaacaaccgcgg
gtggatgccagcgcggaagggctggccagcctgcagcccaccttcgatcgccttggatcg
gtgaccgccggcaacgcctcaagcatcaatgacggcgcggcggcggtaatgatgatgagc
gaggctaaagcgctggagctggggctgccgatccttgcgcggatccgcgccttcgccagc
gtcggcgtcgatccggcgctgatgggcattgccccggtgcatgccacccgtcgctgtctg
gagcgggccggctggcggctggacgacgtcgatctgatcgaagccaatgaggcctttgcc
gctcaggcgatctcggttggccgggtactggagtgggatgagcgccgggtcaacgtcaac
ggcggcgcgatcgccctcggccaccccatcggcgcctccggctgccggattctggtgtcg
ctggtgcatgaaatgatcaagcgcgatgcccgcaaaggtctggcgacgctgtgcattggc
ggcggtcagggcgtggcgctggcggtagaacgcgcatag

DBGET integrated database retrieval system