KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_1771Help
Entry
KPR_1771          CDS       T02793                                 

Gene name
cscA
Definition
(GenBank) similar to sucrose-6-phosphate hydrolase from Escherichia coli (sp|P40714)
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KPR_1771 (cscA)
   00500 Starch and sucrose metabolism
    KPR_1771 (cscA)
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KPR_1771 (cscA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1862770..1864212
Genome map
AA seq 480 aa AA seqDB search
MKMMTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHP
YSTQWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKF
HGDPGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDSWYMVVGAR
EGDTGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAG
FSNCNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFATPDGRRIVIGWLDMWE
SPLPEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVD
NCEAMEVNLRWDCARSSAEQYGLRFGDGLRIYVDAQQQRLVLERHYPQYGLCGTRSVPLT
AGADLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPRRELALFAWSGSAALTEAGAWQLE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgatgacttacacaatctcccgggctgaacaggtactccagacacaacgccag
gcgctgaatctgcgctggtatccgcactatcacctggcggctcgcgccgggtggatcaac
gacccaaacggtctggtgtggttcgacggctggtaccatgccttttatcaacatcacccg
tactccacccagtggggaccgatgcactgggggcacgcgcgcagtaaggatctggtgcac
tgggagcatttgccggtagccctggcgccggagggcccggaggataaagacggctgcttt
tccggctcggcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttc
cacggtgatcctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgc
gacgggatccactttgagcgccaggggatggtggtcgacaccccgccgggtatgcaccac
ttccgtgacccgaaggtctggcgtgagggagatagctggtacatggtcgtcggcgcgcgc
gaaggcgataccggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggac
gcgggggtgctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttc
ttcaccctcaacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcgggg
ttcagcaactgcaatctgttccagagcggctatctgatcggcgagtggcagccaggccag
cgttttattcgccatggcgaattccgggagatggataacggccacgatttctatgccccg
caaagcttcgccacccccgatggccggcggatcgtgattggctggctggatatgtgggaa
tcgccgctgccggagcagcaggacggctgggcgggcatgctctccttgccgcgcgagctg
agcctgagtgcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgc
ggcgcctggttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgac
aactgcgaggcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcag
tatggtctgcgctttggcgatggcctgcgcatctacgtggatgcccaacagcagcgtctg
gtgctggagcggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgacc
gccggagcggatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtc
aatgacggcgaagcttgcctgagcagccgtatctatccgcaggctccccgccgtgaatta
gcgttatttgcctggagcggctcggcggcattaaccgaagccggcgcctggcagctcgaa
taa

DBGET integrated database retrieval system