KEGG   Klebsiella pneumoniae: KPR_2026Help
Entry
KPR_2026          CDS       T02793                                 

Definition
hypothetical protein
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
kpr  Klebsiella pneumoniae
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    KPR_2026
   01230 Biosynthesis of amino acids
    KPR_2026
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPR_2026
   00290 Valine, leucine and isoleucine biosynthesis
    KPR_2026
Enzymes [BR:kpr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     KPR_2026
    2.6.1.66  valine---pyruvate transaminase
     KPR_2026
Amino acid related enzymes [BR:kpr01007]
 Aminotransferase (transaminase)
  Class I
   KPR_2026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2115795..2116718)
Genome map
AA seq 307 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLQEIVEIARQHNLIIFADEIYDKILYDEAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
IPGGTPV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccatcgaaaaatccagcaagttagagaacgtctgttatgacatccgcggcccg
gttctgaaagaagccaaacgtcttgaagaagaaggcaataaggttctgaaactgaacatc
ggcaacccggcgccattcggcttcgaggctcctgacgagatcctcgtcgacgtcatccgc
aatttgcctaccgcccaaggttactgcgattcgaaaggattgtactcggcgcgtaaagct
atcatgcagcattaccaggcccggggtatgcgcgatgtcacggtggaagacatctatatc
ggcaacggcgtgtccgagctgattgtgcaggcgatgcaggcgctgttaaacagcggcgat
gagatgctggttcccgccccggactacccgctgtggacggcggcggtgtcgctttccagc
ggcaaagcggtgcactatctgtgtgacgaatcctctgactggttcccggatctggacgac
atccgcgcaaaaatcacaccgcgcacccgcgggatcgtgatcattaaccctaacaacccc
accggcgcggtctattccaaagaattgctgcaggagatcgtggagatcgctcgtcagcat
aatctgatcattttcgccgatgaaatttacgacaagatcctctacgacgaagcccagcat
cactctattgccgccctggcgccggacctgctgacggtgacctttaacggattgtcgaaa
acctatcgcgttgccggcttccgtcagggctggatggtgctgaatggcccgaaaaaacac
gcgaagggctatatcgaagggctggagatgctggcttcaatgcgtctgtgcgccaacgtg
ccggcccagcatgctatccagacggcgctgggcggctatcagagcatcagcgaattcatc
atccccggcgggacgcctgtatga

DBGET integrated database retrieval system