KEGG   Klebsiella pneumoniae: KPR_2534Help
Entry
KPR_2534          CDS       T02793                                 

Gene name
glsA
Definition
hypothetical protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
kpr  Klebsiella pneumoniae
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPR_2534 (glsA)
   00330 Arginine and proline metabolism
    KPR_2534 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    KPR_2534 (glsA)
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     KPR_2534 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2621318..2622244
Genome map
AA seq 308 aa AA seqDB search
MATVINNAMLEAILAEIRPLIGRGKVADYIPALASVSGDKLGIAISTVDGQHFAAGDAHE
RFSIQSISKVLSLVVAMNHYQEEEIWQRVGKDPSGQPFNSLLQLEIEQGKPRNPFINAGA
LVVCDMLQSRLSAPRQRMLEIVRRLSGVADIAYDPVVARSEFEHSARNAAIAWLMKSFGN
FHNDVATVLQNYFHYCSLEMSCVELARTFLFLADRGIAPHLDAPVIAPIQSRQVNALMMT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPQEMAIAVWSPELDDAGNSLAGVAMLEKLT
QRMGRSVF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacggttatcaataatgcaatgctggaagccattctggcagaaatcaggccgctg
attggccgcggaaaagtggcggattatattccggcgctggccagcgtcagcggcgacaag
cttggtatcgcgatcagtacggtggacggtcagcactttgccgctggcgatgcccatgaa
cgtttttccatccagtcaatctccaaggtattgagcctagtggtggccatgaaccactat
caggaggaggagatctggcagcgggtggggaaagatccttccggccagccctttaactcg
cttctgcagctggagatcgagcagggcaaaccgcgcaacccgtttatcaacgccggggca
ctggtggtctgcgacatgctgcagagccggctcagcgccccgcgtcagcggatgctggag
attgtccgccgtctgagcggcgtggccgatatcgcctacgatccggtggtggctcgctca
gagtttgagcattcggcgcgcaacgccgccatcgcctggctgatgaaatcctttggtaac
ttccataacgacgtcgccaccgtgctgcagaactatttccactactgttcgctggagatg
agctgcgttgagctggcgcgaacctttctgtttctcgccgaccgcggcattgccccgcat
ctcgacgcgccggttattgcgcccatccagtcccgccaggtgaatgccctgatgatgacc
agcggcatgtaccagaatgctggtgaattcgcctggcgcgttggcctgccggcgaaatca
ggcgtcggcggcgggatcgtggcgattgtcccgcaggagatggcgatcgccgtgtggagc
ccggagcttgacgacgccgggaactcgctggccggcgtggcgatgctggaaaaactgact
cagcggatggggaggtcggtgttctga

DBGET integrated database retrieval system