KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_2663Help
Entry
KPR_2663          CDS       T02793                                 

Gene name
mhpF
Definition
(GenBank) highly similar to acetaldehyde dehydrogenase from Klebsiella pneumoniae strain 342 (sp|B5XQJ3)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00360  Phenylalanine metabolism
kpr00362  Benzoate degradation
kpr00620  Pyruvate metabolism
kpr00621  Dioxin degradation
kpr00622  Xylene degradation
kpr00650  Butanoate metabolism
kpr01100  Metabolic pathways
kpr01120  Microbial metabolism in diverse environments
kpr01220  Degradation of aromatic compounds
Module
kpr_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPR_2663 (mhpF)
   00650 Butanoate metabolism
    KPR_2663 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KPR_2663 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPR_2663 (mhpF)
   00622 Xylene degradation
    KPR_2663 (mhpF)
   00621 Dioxin degradation
    KPR_2663 (mhpF)
Enzymes [BR:kpr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KPR_2663 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA 2-Hacid_dh_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: CCI76893
UniProt: R4Y9J3
Position
complement(2745393..2746298)
Genome map
AA seq 301 aa AA seqDB search
MPPEKEIVMRKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGMARARRLGV
ATTHEGVGGLMQMAEFADIDFVFDATSAGAHIKNDAALREAKPGIRVIDLTPAAIGPYCV
PVVNLADNLHQGNVNMVTCGGQATIPMIAAVSRVAKVHYAEIVASIASQSAGPGKGKAII
VLNPAEPPLMMRDTVYVLSELASQEAIAASIAEMAAAVQAYVPGYRLKQQVQFEVIPEDR
PVNLPGVGCFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALATAEQMAGAMHSAAGAT
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgccgccggagaaggagatcgtgatgcgtaaacgtaaagtcgccattatcggctccggg
aatatcggcaccgatttaatgattaaaatcctgcgccacggccagcatctggagatggcg
gtgatggtcggcatcgacccgcagtcggatggcatggcccgcgcccggcgcctgggcgtt
gcgaccactcacgaaggggtgggcggcctgatgcagatggcggaatttgccgacatcgat
tttgtttttgacgccaccagcgccggggcgcacatcaaaaacgatgccgcgctgcgcgaa
gcgaagccggggatccgcgttatcgacctgacgccggcggcgattggcccgtactgcgta
ccggtggtcaacctcgcggacaatctccatcagggcaacgtcaatatggtgacctgcggc
gggcaagcgaccatcccgatgatcgccgcggtctcgcgagtggcgaaggtgcattacgcg
gagattgtggcctcgatcgccagtcaatccgccgggccgggcaagggcaaagcgattatt
gtactgaaccctgcggagccgccgctgatgatgcgcgataccgtctacgtcctgagcgag
ctggcgtcgcaggaggcgattgccgcctcgatcgccgaaatggcggcggcagtgcaggct
tacgtcccgggctaccggctgaagcagcaggtgcagtttgaggttatccccgaggacagg
ccggtcaacctgcccggcgtcggctgtttttccggcctgaaaaccgcggtttacctcgaa
gtggaaggggcggcgcactatctgccagcgtacgcgggcaacctcgatattatgacctcg
gcggcgctggcgacggcggagcaaatggccggggcaatgcacagcgcggcgggagcgaca
gcatga

DBGET integrated database retrieval system