KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_2663Help
Entry
KPR_2663          CDS       T02793                                 

Gene name
mhpF
Definition
(GenBank) highly similar to acetaldehyde dehydrogenase from Klebsiella pneumoniae strain 342 (sp|B5XQJ3)
  KO
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KPR_2663 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPR_2663 (mhpF)
   00650 Butanoate metabolism
    KPR_2663 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KPR_2663 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPR_2663 (mhpF)
   00622 Xylene degradation
    KPR_2663 (mhpF)
   00621 Dioxin degradation
    KPR_2663 (mhpF)
Enzymes [BR:kpr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KPR_2663 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2745393..2746298)
Genome map
AA seq 301 aa AA seqDB search
MPPEKEIVMRKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGMARARRLGV
ATTHEGVGGLMQMAEFADIDFVFDATSAGAHIKNDAALREAKPGIRVIDLTPAAIGPYCV
PVVNLADNLHQGNVNMVTCGGQATIPMIAAVSRVAKVHYAEIVASIASQSAGPGKGKAII
VLNPAEPPLMMRDTVYVLSELASQEAIAASIAEMAAAVQAYVPGYRLKQQVQFEVIPEDR
PVNLPGVGCFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALATAEQMAGAMHSAAGAT
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgccgccggagaaggagatcgtgatgcgtaaacgtaaagtcgccattatcggctccggg
aatatcggcaccgatttaatgattaaaatcctgcgccacggccagcatctggagatggcg
gtgatggtcggcatcgacccgcagtcggatggcatggcccgcgcccggcgcctgggcgtt
gcgaccactcacgaaggggtgggcggcctgatgcagatggcggaatttgccgacatcgat
tttgtttttgacgccaccagcgccggggcgcacatcaaaaacgatgccgcgctgcgcgaa
gcgaagccggggatccgcgttatcgacctgacgccggcggcgattggcccgtactgcgta
ccggtggtcaacctcgcggacaatctccatcagggcaacgtcaatatggtgacctgcggc
gggcaagcgaccatcccgatgatcgccgcggtctcgcgagtggcgaaggtgcattacgcg
gagattgtggcctcgatcgccagtcaatccgccgggccgggcaagggcaaagcgattatt
gtactgaaccctgcggagccgccgctgatgatgcgcgataccgtctacgtcctgagcgag
ctggcgtcgcaggaggcgattgccgcctcgatcgccgaaatggcggcggcagtgcaggct
tacgtcccgggctaccggctgaagcagcaggtgcagtttgaggttatccccgaggacagg
ccggtcaacctgcccggcgtcggctgtttttccggcctgaaaaccgcggtttacctcgaa
gtggaaggggcggcgcactatctgccagcgtacgcgggcaacctcgatattatgacctcg
gcggcgctggcgacggcggagcaaatggccggggcaatgcacagcgcggcgggagcgaca
gcatga

DBGET integrated database retrieval system