KEGG   Klebsiella pneumoniae: KPR_2663Help
Entry
KPR_2663          CDS       T02793                                 

Gene name
mhpF
Definition
hypothetical protein
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
kpr  Klebsiella pneumoniae
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KPR_2663 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPR_2663 (mhpF)
   00650 Butanoate metabolism
    KPR_2663 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KPR_2663 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPR_2663 (mhpF)
   00622 Xylene degradation
    KPR_2663 (mhpF)
   00621 Dioxin degradation
    KPR_2663 (mhpF)
Enzymes [BR:kpr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KPR_2663 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2745393..2746298)
Genome map
AA seq 301 aa AA seqDB search
MPPEKEIVMRKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGMARARRLGV
ATTHEGVGGLMQMAEFADIDFVFDATSAGAHIKNDAALREAKPGIRVIDLTPAAIGPYCV
PVVNLADNLHQGNVNMVTCGGQATIPMIAAVSRVAKVHYAEIVASIASQSAGPGKGKAII
VLNPAEPPLMMRDTVYVLSELASQEAIAASIAEMAAAVQAYVPGYRLKQQVQFEVIPEDR
PVNLPGVGCFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALATAEQMAGAMHSAAGAT
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgccgccggagaaggagatcgtgatgcgtaaacgtaaagtcgccattatcggctccggg
aatatcggcaccgatttaatgattaaaatcctgcgccacggccagcatctggagatggcg
gtgatggtcggcatcgacccgcagtcggatggcatggcccgcgcccggcgcctgggcgtt
gcgaccactcacgaaggggtgggcggcctgatgcagatggcggaatttgccgacatcgat
tttgtttttgacgccaccagcgccggggcgcacatcaaaaacgatgccgcgctgcgcgaa
gcgaagccggggatccgcgttatcgacctgacgccggcggcgattggcccgtactgcgta
ccggtggtcaacctcgcggacaatctccatcagggcaacgtcaatatggtgacctgcggc
gggcaagcgaccatcccgatgatcgccgcggtctcgcgagtggcgaaggtgcattacgcg
gagattgtggcctcgatcgccagtcaatccgccgggccgggcaagggcaaagcgattatt
gtactgaaccctgcggagccgccgctgatgatgcgcgataccgtctacgtcctgagcgag
ctggcgtcgcaggaggcgattgccgcctcgatcgccgaaatggcggcggcagtgcaggct
tacgtcccgggctaccggctgaagcagcaggtgcagtttgaggttatccccgaggacagg
ccggtcaacctgcccggcgtcggctgtttttccggcctgaaaaccgcggtttacctcgaa
gtggaaggggcggcgcactatctgccagcgtacgcgggcaacctcgatattatgacctcg
gcggcgctggcgacggcggagcaaatggccggggcaatgcacagcgcggcgggagcgaca
gcatga

DBGET integrated database retrieval system