KEGG   Klebsiella pneumoniae: KPR_2901Help
Entry
KPR_2901          CDS       T02793                                 

Definition
hypothetical protein
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
kpr  Klebsiella pneumoniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPR_2901
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     KPR_2901
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     KPR_2901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2991876..2993510)
Genome map
AA seq 544 aa AA seqDB search
MRVMQREEWFHRAVIYQVDSSLFYDANGDGFGDLAGIRQKLHYIRSLGATVLWLTPFYLT
PLQDDGYDISDHLQPDPRFGTIADVIELIARARELGLRVIIELVIQHTSAQHPWFQAARR
DPWSPWRPYYLWADRPPENDDPPMFPGVEESVWRWDEQAGQYYRHMFYHHEPDLNLAHPP
VIAEIENIITFWLQAGVSGFRLDAASHLVKQTGKGDETRGYPLLTHLRQVVQRLNPDAIL
LGEVDVAVEDYRHYFGQGDRLQMVLNFWLNKYLYLSLAQQRAAPVVKALQAMVTPPDGCC
FVNWLRNHDELDLEGIGERNKRQVIRTFAPDKSMSVYQRGVCRRLAPMLDGDTRRIALAH
AILLALPGLPVMRYGDEIGMGDDLSLPERYAVRTPMQWSAAANAGFSRTARDDLPVKPVA
SGRFRYQRINVETALRHPRSLLHRVRNMVLARTEYTEPGSLPFTLLTLKPDAVLGLLYRS
ESREVLMLANCSQQAVEVLLPPLAEGYWSPILEDKLYQDGLHGGKDARLALSGYGYRWFS
RSLS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgagagtgatgcaacgggaagagtggtttcacagagcggtcatctatcaggttgacagt
tcgctcttttatgatgccaatggcgatggttttggcgatctcgcgggcattcgccaaaag
ctacactacattcgcagcctcggagcgacggtgctctggctgactccgttctatctcact
cctctgcaggatgatggctatgatatcagcgatcatctgcagcccgatccgcggttcggc
actatcgctgacgtgattgagctgattgcccgcgcccgcgagctgggactgcgggtgatc
attgagctggtgatccagcacacctccgcgcagcacccgtggttccaggcggcgcgacgc
gatccctggtcgccgtggcggccgtattatctgtgggccgatcggccgccggaaaacgac
gatcctcccatgtttcccggcgttgaggagagcgtctggcgctgggacgaacaggctggg
caatattatcgccacatgttttatcaccacgagcccgacctgaatctcgcccatccgccg
gtgatcgctgaaatcgaaaacattatcaccttctggctgcaggctggggtgtcgggcttt
cgtctcgatgccgcgtcacatctggtcaagcagaccggaaagggcgacgagacgcgcggc
tacccgctgctgacccatctccggcaggttgtacagcgcctcaatcccgatgcgatactc
ctgggtgaagtggacgtcgcggtagaagattaccgtcattatttcggccagggcgatcgg
ctgcagatggtgcttaatttctggcttaacaaatacctctacctcagcctggcgcagcag
cgcgccgcgccggtggtgaaggccctgcaggcgatggtgaccccgccggacgggtgctgc
ttcgtcaactggctgcgcaaccatgatgaactggatcttgaggggattggcgagcgcaac
aagcgccaggttatccgcacctttgcccctgataaatcgatgtccgtttaccagcgcggc
gtatgccgaagactggcgccgatgctggacggcgatacccgacgcatagcgttagcccat
gctatcctgctggcgctgcccggcttgccggtgatgcgctatggcgacgagattggcatg
ggtgacgatctctccttaccggagcgctacgcggtcagaacgccgatgcagtggtcagcc
gcggccaacgccggcttttcccggacggcgcgggatgatttgccggtaaaaccggtggcc
agcgggcggttccgctaccaacggatcaatgtcgaaacggcgctgcgccatcccaggtcg
ctgctgcatcgggtacgcaatatggtattggcgcgcacggaatatactgaaccgggatcc
ctcccttttactctccttaccctaaagcccgacgcggtgctgggcttgctctatcgcagc
gaatcgcgggaggtactgatgctggccaactgcagccagcaggcggtagaggtcctgctc
ccgccgctggccgagggctactggagcccaattctggaagataagctctatcaggatggg
ctgcacggcgggaaagatgcgcggctggcactctccgggtatggttaccgttggttcagc
cgcagcctgagttag

DBGET integrated database retrieval system