KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_3118Help
Entry
KPR_3118          CDS       T02793                                 

Gene name
adhE
Definition
(GenBank) highly similar to aldehyde-alcohol dehydrogenase from Escherichia coli strain K12 (sp|P0A9Q7)
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00010  Glycolysis / Gluconeogenesis
kpr00071  Fatty acid degradation
kpr00350  Tyrosine metabolism
kpr00620  Pyruvate metabolism
kpr00625  Chloroalkane and chloroalkene degradation
kpr00626  Naphthalene degradation
kpr00650  Butanoate metabolism
kpr01100  Metabolic pathways
kpr01110  Biosynthesis of secondary metabolites
kpr01120  Microbial metabolism in diverse environments
kpr01130  Biosynthesis of antibiotics
kpr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPR_3118 (adhE)
   00620 Pyruvate metabolism
    KPR_3118 (adhE)
   00650 Butanoate metabolism
    KPR_3118 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    KPR_3118 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    KPR_3118 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPR_3118 (adhE)
   00626 Naphthalene degradation
    KPR_3118 (adhE)
Enzymes [BR:kpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPR_3118 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KPR_3118 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: CCI77346
UniProt: R4YFG8
Position
3189540..3192215
Genome map
AA seq 891 aa AA seqDB search
MAVTNIAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKAIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKEATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
AAKIAELAGFTVPATTKILIGEVTNVDESEPFAHEKLSPTLAMYRAKDFEDAVAKAEKLV
AMGGIGHTSCLYTDQDNQPARVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLTIVRKGADLANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGREFVEGEAGAKAEVAPVKAEKKAKKSA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatatcgctgaactgaacgcgcttgttgagcgtgtcaagaaagcccag
cgtgaatatgccagtttcactcaagaacaagtcgacaaaatcttccgcgccgccgctctg
gccgctgcagatgctcgaatccctctcgccaaaatggccgtagccgaatccggcatgggc
atcgttgaagacaaagcgatcaaaaaccacttcgcttccgaatacatttacaacgcttat
aaagacgaaaaaacctgtggcgttctgtcagaagacgacacctttggcaccatcactatt
gctgagcctatcggcatcatctgcggtatcgtaccgaccactaacccgacttcaacagcc
attttcaaatcgctcatcagtctgaaaacgcgtaacgccatcattttctctccgcacccg
cgtgcaaaagaagccaccaacaaagcggctgatatcgtgctgcaggctgccatcgcggcc
ggcgcgccgaaggacctgattggctggatcgatcagccgtctgtagaactgtctaacgcg
ctgatgcatcacccggacatcaacctgatcctggcgaccggtggtccaggcatggtgaaa
gcagcatacagctccggtaaacctgctatcggcgtcggcgccggtaacaccccggtagtc
attgatgaaaccgccgacatcaaacgtgccgtagcgtccgtactgatgtctaaaaccttc
gataacggcgtgatctgtgcttctgagcagtccgttgtggtggttgattcagtctatgac
gcggttcgcgaacgtttcgccagccacggcggctacctgctgcagggtaaagagctgaaa
gccgttcaggacattatcctgaaaaatggcgcgctgaacgcggctatcgttggtcagcca
gcggccaaaatcgctgaactggcaggcttcaccgtgccggccaccaccaaaattctgatt
ggtgaagtgaccaacgttgacgagagcgagccgtttgctcacgaaaaactgtctccgacg
ctggctatgtaccgtgcaaaagatttcgaagacgcggtagccaaagcagaaaaactggtc
gccatgggcggtatcggtcacacctcttgcctgtacaccgaccaggacaaccagccggct
cgcgtggcttacttcggccaaatgatgaaaaccgcgcgtatcctgatcaacaccccggct
tctcagggtggtatcggtgacctgtacaacttcaaactcgcgccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgtcgtggctccctgccaatcgcactggatgaagtgattaccgatggtcacaaa
cgcgcgctgatcgtgactgaccgcttcctgttcaacaacggctatgccgatcagatcact
tccgtactgaaagcagcgggtgttgaaacggaagtcttcttcgaagttgaagctgacccg
acgctgaccatcgtacgtaaaggtgccgacctggcgaactcctttaaaccagacgtgatc
atcgccctgggcggcggttccccgatggatgcggcgaaaatcatgtgggttatgtacgaa
catccggaaacccacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtcaaagccaagatggtggcgatcactaccacttccggt
accggttctgaagtgacgccgttcgccgtggtgaccgatgacgcgaccggtcagaaatac
ccgctggcagactacgcgctgaccccggatatggccattgtcgatgccaacctggtgatg
gatatgccgaaatcgctgtgtgcgttcggtggtctggatgcggtgactcacgccctggaa
gcttacgtttccgtactggcttctgagttctctgacggccaggcgctgcaggcgctgaaa
ctgctgaaagagtatctgccggcttcctatcacgaaggttctaagaacccggttgcccgt
gagcgcgtacacagtgccgcgactatcgccggtatcgcgttcgctaacgccttcctcggc
gtgtgtcactcgatggcgcacaaactgggctcccagttccatattccgcacggtctggcc
aacgccctgctgatctgcaacgttatccgctataacgcgaatgacaacccgaccaagcag
accgcgttcagccagtacgaccgtccgcaggctcgtcgtcgttacgctgaaatcgccgat
cacctgggcctctccgcaccaggcgaccgcaccgcagcgaaaatcgagaaactgctggca
tggctggaaagcattaaagctgagctgggtattccgaaatctatccgcgaagctggcgtt
caggaagctgacttcctggcccacgttgataaactgtctgaagatgcattcgatgaccag
tgcaccggcgctaacccgcgctacccgctgatctccgaactgaaacagatcctgctggat
acctactacggccgcgaattcgtcgaaggcgaagccggtgcgaaagccgaagttgctccg
gtaaaggctgagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system